CCR1 targeting chimeric antigen receptor and application thereof
A chimeric antigen receptor and targeting technology, applied in the direction of polypeptides containing positioning/targeting motifs, receptors/cell surface antigens/cell surface determinants, hybrid peptides, etc., can solve the problem of chimeric antigen receptors Lack of other issues
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0057] Embodiment 1 vector construction
[0058] The structure of the chimeric antigen receptor CCR1 CAR constructed in this example is as follows figure 1 shown. According to the amino acid sequence of the chimeric antigen receptor, the whole gene was synthesized in Guangzhou Aiji Biotechnology Co., Ltd. and constructed into a lentiviral expression vector. The vector structure of CCR1 CAR is as follows: figure 2 As shown, the sequence information is shown below.
[0059] CCR1 CAR amino acid sequence:
[0060]MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCSASQGIRNYLNWYQQKPGKVPKLLIVYTSRLHSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQYGKLPYTFGQGTKLEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDAWMDWVRQAPGKGLEWVGEIRSKVNNHETYYAESVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCARNDYFDYWGQGTTVTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTY...
Embodiment 2
[0063] Example 2 Flow cytometric detection of the expression of CCR1 on the surface of tumor cells
[0064] After co-incubating with target cells with APC anti-human CCR1 Antibody antibody (biolegend brand), the expression of CCR1 in U937, THP-1, HL60, KG1a, Jurkat, Daudi, RPMI8226, NCI-H929, Raji and K562 cells was detected by flow cytometry . Such as image 3 The results showed that U937, THP-1, RPMI8226 and NCI-H929 were CCR1 positive cells, and HL60, KG1a, Jurkat, Daudi, Raji and K562 were CCR1 negative cells.
Embodiment 3
[0065] Example 3 Preparation of anti-CCR1 CAR-T cells
[0066] (1) Separation of PBMCs
[0067] Collect 50mL of peripheral blood; add 15mL of lymphocyte separation medium to two 50mL sterilized centrifuge tubes in the ultra-clean workbench, slowly inject 25-30mL of peripheral blood into the centrifuge tubes containing lymphocyte separation Centrifuge the centrifuge tube at 700g for 20 minutes at room temperature, increase the speed by 1, and decrease the speed by 2. If the blood is stored for more than 2 hours, increase the centrifugation time to 30 minutes;
[0068] After centrifugation, the blood is divided into 4 layers, which are composed of plasma (upper layer), mononuclear cells between plasma and separation liquid (2nd layer), separation liquid (3rd layer) and red blood cells (bottom layer). Collect the mononuclear cells into a new centrifuge tube, add 20mL PBS to dilute the cell suspension, centrifuge at 500g for 10min; remove the supernatant, add 20mL PBS to dilute t...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


