Nanoparticles for resisting H1N1 subtype influenza A virus based on self-assembled ferritin as well as preparation method and application of nanoparticles

An influenza virus and nanoparticle technology, applied in the field of genetic engineering, can solve the problem that antibodies cannot provide cross-protection, achieve high sensitivity and curative effect, improve accuracy and repeatability, and shorten the treatment process

Pending Publication Date: 2022-07-29
QINGDAO AGRI UNIV
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Influenza A virus has many subtypes, and most antibodies induced by different subtypes cannot provide cross-protection

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Nanoparticles for resisting H1N1 subtype influenza A virus based on self-assembled ferritin as well as preparation method and application of nanoparticles
  • Nanoparticles for resisting H1N1 subtype influenza A virus based on self-assembled ferritin as well as preparation method and application of nanoparticles
  • Nanoparticles for resisting H1N1 subtype influenza A virus based on self-assembled ferritin as well as preparation method and application of nanoparticles

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0048] Example 1 Construction of plasmid signal peptide-SpyTag-ferritin monomer subunit (signal peptide-ST-FE) and signal peptide-SpyCatcher-anti-H1N1 subtype influenza virus hemagglutinin protein Nanobody (signal peptide-SC-HA -VHH)

[0049] First, the gene signal peptide-ST-FE and the signal peptide-SC-HA-VHH were synthesized. The gene tandem structure is as follows figure 1 , and optimized by the codons of the CHO eukaryotic expression system, synthesized by GenScript Biotechnology Co., Ltd. The amino acid sequence of the signal peptide-ST-FE (SEQ ID NO: 1) is as follows:

[0050] MGWSCIILFLVATATGVHSAHIVMVDAYKPTKGGGSGGGSGGGSRMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPKLPGLLMQGGE;

[0051] The amino acid sequence (SEQ ID NO: 2) of the signal peptide-SC-HA-VHH is as follows:

[0052] MGWSCIILFLVATATGVHSSYYHHHHHHDYDIPTTENLYFQGSATHIKFSKRDEDGKELAGATMELRDSSGKTISTW...

Embodiment 2

[0081] Example 2 Linearization of Plasmid Signal Peptide-ST-FE and Signal Peptide-SC-HA-VHH

[0082] Take out the plasmid signal peptide-ST-FE and signal peptide-SC-HA-VHH stored at -20°C, and measure their concentrations by NanoDrop one to be 1200ng / μL and 890ng / μL, respectively, and use the restriction endonuclease PvuⅠ for single enzyme Cut, concrete reaction system is shown in following table 3, table 4:

[0083] Table 3 Plasmid signal peptide-ST-FE single digestion reaction system

[0084]

[0085] Table 4 Plasmid signal peptide-SC-HA-VHH single enzyme digestion reaction system

[0086]

[0087] Add each component according to the single enzyme digestion reaction system table, and place it in a 37°C water bath for 2h digestion.

[0088] During digestion, prepare a 1% agarose gel. First, prepare the gel plate, select and insert the comb according to the total enzyme digestion system, then weigh 0.5g of agarose into a 100mL beaker, weigh 50mL of 1×TAE with a gradua...

Embodiment 3

[0089] Example 3 Electrotransfection of linear signal peptide-ST-FE and signal peptide-SC-HA-VHH GS gene deletion CHO cells

[0090] (1) Preparation before electroporation of CHO suspension cells lacking GS gene. 24h before electroporation, cells were at a viable cell density of 5×10 5 The cells / mL were inoculated into a 125 mL conical flask for shaking culture, the culture volume was 30 mL, and the rotational speed of the carbon dioxide shaking incubator was set to 110 rpm.

[0091] (2) Collection of CHO suspension cells lacking GS gene. On the day of electroporation, samples were taken to calculate the viable cell density and viability (98%) of suspension culture, and 1×10 cells were collected by calculation. 7 The cell suspension volume required for each viable cell was placed in a sterile centrifuge tube, centrifuged at 1000 rpm for 5 min, and then resuspended in 400 μL of 302 medium (containing glutamine).

[0092] (3) Incubation of cells with plasmids. Add 40 μg of l...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses nanoparticles for resisting H1N1 subtype influenza A virus based on self-assembled ferritin as well as a preparation method and application of the nanoparticles, and relates to the technical field of genetic engineering. The nanoparticle is formed by connecting a signal peptide-ST-FE fusion protein and a signal peptide-SC-HA-VHH fusion protein in vitro, the signal peptide-ST-FE fusion protein is obtained by connecting a signal peptide-SpyTag as shown in SEQ ID NO: 3 to the N end of a ferritin monomer subunit; the signal peptide-SC-HA-VHH fusion protein is obtained by connecting the end N of a nano antibody of an anti-H1N1 subtype influenza A virus hemagglutinin protein with a signal peptide-SpyCatcher as shown in SEQ ID NO: 4. The invention further discloses a preparation method of the signal peptide-SC-HA-VHH fusion protein. The nanoparticles for resisting the influenza A (H1N1) subtype virus, disclosed by the invention, have great significance in monitoring, preventing and treating the influenza A (H1N1) subtype virus.

Description

technical field [0001] The invention relates to the technical field of genetic engineering, in particular to a self-assembled ferritin-based anti-influenza A H1N1 subtype influenza virus nanoparticle and a preparation method and application thereof. Background technique [0002] Influenza is very common in actual production and life. It is caused by human or animal infection with influenza virus. The typical clinical symptoms of influenza include acute high fever, body pain, fatigue and respiratory symptoms. Influenza itself has obvious seasonality, with high incidence in autumn and winter. Some highly contagious viruses can cause influenza pandemics on a large scale or even globally, and there are very serious complications and even individual death due to differences in individual physiques. The phenomenon. Influenza viruses can be roughly divided into three different types. These three different types are A, B, and C, which can also be called A, B, and C. [0003] H1N1 ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K19/00C12N15/85B82Y5/00B82Y40/00A61K39/42A61K39/44A61P31/16
CPCC07K16/1018C07K14/315C07K14/47C12N15/85B82Y5/00B82Y40/00A61K39/42A61K39/44A61P31/16C07K2319/02C07K2317/569C12N2800/22C12N2800/107Y02A50/30C07K2317/22C07K2319/70C07K2319/735A61K2039/505
Inventor李军伟刘洪港赵美霞马清霞
OwnerQINGDAO AGRI UNIV