Polymer-modified synthetic proteins

a technology of synthetic proteins and polypeptides, which is applied in the direction of peptides/protein ingredients, animal/human proteins, peptides, etc., can solve the problems of lack of post-translational modifications that are normally found in the natural production form of the protein, lack of modification can have a significant negative impact on the pharmaceutical properties of the protein, and the use of recombinant dna techniques is not universally successful

Inactive Publication Date: 2006-10-19
AMYLIN PHARMA INC
View PDF84 Cites 40 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

The present invention concerns polymer-modified synthetic bioactive proteins that mimic the bioactivity of natural proteins. These proteins are produced using chemical synthesis and have a monomer molecular weight greater than about 25 kDa. They can have one or more irregular amino acid residues and can be modified to mimic the bioactivity of a ribosomally specified protein. The invention also provides pharmaceutical compositions containing these proteins and methods of treating human diseases or conditions by administering them to an individual in need. The invention also describes methods of producing the polymer-modified synthetic bioactive proteins.

Problems solved by technology

Unfortunately, recombinant proteins made in bacterial cells, such as E. coli, often lack post-translational modifications that are normally found in the protein's naturally produced form.
This lack of modification can have a significant negative impact on the pharmaceutical properties of the protein when introduced to a patient.
A significant problem in making recombinant glycoproteins is that the resulting product typically consists of a complex mixture of different ‘glycoforms’, which may have widely varying physiological or pharmacological properties.
Unfortunately, the use of recombinant DNA techniques has not been universally successful.
Recovery of protein from these bodies has presented numerous problems, such as how to separate the protein encased within the cell from the cellular material and proteins harboring it, and how to recover the inclusion body protein in biologically active form.
Unfortunately, such labeled proteins offer little to no therapeutic advantage over their recombinantly produced counterparts.
While potency is an important aspect in making a therapeutic, other factors remain problems with protein therapeutics.
Efforts to develop therapeutically usable protein drugs have long suffered from the undesirable bioactivity, bioavailability and biokinetics (such as clearing time, etc.) of putative drug candidates upon in vivo administration.
In the case of enzymes, not only is there a problem of destruction of the polypeptide and the subsequent negation of its physiological activity but also the most undesired elicitation of an allergic reaction.
Conversely, certain proteins, such as clotting factors, growth factors and cytokines, etc., may exhibit a biological half-life that is disadvantageously prolonged upon their in vivo administration.
Although many different approaches have been described for conjugation of polymers to proteins, the conjugation process is not without complications.
However, if too much of the activated polymer is attached to the target protein or polypeptide, biological activity can be severely reduced or lost.
Likewise, if the wrong linker joining the polymer to the protein is used or an insufficient amount of polymer is attached to the target, the therapeutic value of the resultant conjugate may be limited, and may not demonstrate enough of an increase in circulating life to compensate for the loss in its bioactivity.
Problems can also result due to a blockage of the protein's active site by the modifying polymer.
This problem can be difficult to avoid since the polymer and protein are typically joined in solution-based reactions.
These problems are particularly acute with lower molecular weight proteins and peptides, which often have few attachment sites not associated with bioactivity.
Both approaches represent significant problems as most proteins contain multiple copies of such reactive groups spread out over various regions of the polypeptide backbone that play an important role in defining the activity, folding, re-folding and stability of a protein.
Thus although widely used, such approaches suffer from more or less incomplete or unwanted reduction in bioactivity of a protein, and usually complex mixtures that are difficult to separate and characterize (Delgada et al., Pharmaceutical Sciences (1997) 3:59-66).
While such cysteine or lysine variants theoretically allow site-specific polymer attachment, there still is no guarantee that all selected sites can be modified in a controlled manner.
However, modification of the N- or C-termini typically reduces a protein's activity (See, e.g., U.S. Pat. No. 5,985,265 discussing attachment of PEG to the N-terminus and lysine side chains of G-CSF).
Another problem is that all of the above-discussed polymers are highly non-homogeneous, which render analytical characterization and purification of the mixtures of polymer-modified proteins difficult (Delgada et al., Pharmaceutical Sciences (1997) 3:59-66).
Although the use of polypeptide adducts might be considered to offer a possible solution in principle, the use of polypeptides is disadvantageous since they are susceptible to proteolytic cleavage and can render the derivatized protein immunogenic.
Unfortunately, however, the problem of identifying and employing a suitable polymer is exacerbated by the fact that all proteins currently employed for therapeutic use are derived from recombinant DNA technologies.
The use of recombinant DNA technologies puts severe limitations on the types and specificity of linkages that can be formed between a performance-enhancing moiety and the recombinantly produced protein.
This is because firstly there are only a very limited number of functional groups suitable for linkage, and secondly there will generally be several copies of the reactive functional group in the protein being modified, thus precluding any specificity of modification.
Also, if differing numbers of such moieties are randomly attached, the pharmacokinetics of the therapeutic protein cannot be precisely predictable, making dosing a large problem.
The lack of control of attachment furthermore may lead to (a) reduced potency, (b) a need for elaborate purification schemes to separate a vast mixture of derivatives and (c) possibly unstable attachment of the modifying moiety.
Also, because of the limited success in attaching polymers at precise user-defined sites, very little is known about preferred sites of attachment that could be applicable to proteins in general.
In addition, because of the stochastic nature of attachment, and the hetero-disperse nature of PEG and other water-soluble polymers currently employed for such purposes, purification and analytical characterization of PEG-protein conjugates has been difficult.
Thus the combined problem of poor control over reproducible attachment and polymer heterogeneity has severely hampered the routine approval of polymer-modified proteins as therapeutics (only a few approved to date for therapeutic use despite its introduction in the early 1970's).

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polymer-modified synthetic proteins
  • Polymer-modified synthetic proteins
  • Polymer-modified synthetic proteins

Examples

Experimental program
Comparison scheme
Effect test

example 1

Synthesis of Synthetic Erythropoiesis Stimulating Protein SEP-0

[0388] A Synthetic Erythropoiesis Stimulating Protein (SEP) was Synthesized.

[0389] The sequence of the full-length synthesized protein (designated “SEP-0 (1-166)” is:

(SEQ ID NO:1)APPRLICDSRVLERYLLEAKEAEKITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVKSSQPWψPLQLHVDKAVSGLRSLTTLLRALGAQKψAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

where ψ denotes a non-native amino acid residue consisting of a cysteine that is carboxymethylated at the sulfhydryl group. The SEP-0 protein was synthesized in solution from four polypeptide segments:

Segment SEP-0:1 (GRFN 1711; composed of residues 1-32 of SEQ ID NO:1): [0390] APPRLICDSR VLERYLLEAK EAEKITTGCA EH-thioester

Segment SEP-0:2 (GRFN 1712, composed of residues 33-88 of SEQ ID NO:1): [0391] CSLNEKITVP DTKVNFYAWK RMEVGQQAVE VWQGLALLSE AVLRGQALLV KSSQPW-thioester (where Cys33 is Acm protected)

Segment SEP-0:3 (GRFN 1713, composed of residues 89-116 of SEQ ID NO:1): ...

example 2

Synthesis of Synthetic Erythropoiesis Stimulating Protein SEP-1-L30

[0404] A second synthetic erythropoiesis stimulating protein (designated SEP-1-L30) was synthesized to contain oxime-forming groups at positions 24 and 126 of SEP-0. These groups were then used to form SEP-1-L30, in which linear (EDA-Succ-)18 carboxylate (EDA=(4,7,10)-trioxatridecane-1,13diamine, also called TTD; Succ=—CO—CH2CH2CO—) polymers have been joined to the protein backbone. The sequence of the full-length SEP-1 (1-166) is:

(SEQ ID NO:2)APPRLICDSRVLERYLLEAKEAEKOXITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVKSSQPWψPLQLHVDKAVSGLRSLTTLLRALGAQKψAISPPDAAKOXAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

where ψ denotes an non-native amino acid residue consisting of a cysteine that is carboxymethylated at the sulfhydryl group, and where Kox denotes a non-native lysine that is chemically modified at the ε-amino group with an oxime linker group coupled to a designated water-soluble polymer through an oxime bo...

example 3

Synthesis of Synthetic Erythropoiesis Stimulating Protein SEP-1-L26

[0426] A third synthetic erythropoiesis stimulating protein (designated SEP-1-L26) was synthesized to contain oxime-forming groups at positions 24 and 126 of SEP-0. These groups were then used to form SEP-1-L26, in which the linear polymers (EDA-Succ)18 carboxylate and (EDA-Succ)6-amide have been joined to the protein backbone through oxime linkages at positions 24 and 126, respectively. The sequence of the full-length SEP-1 (1-166) is:

(SEQ ID NO:2)APPRLICDSRVLERYLLEAKEAEKOXITTGCAEHCSLNEKITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVKSSQPWψPLQLHVDKAVSGLRSLTTLLRALGAQKψAISPPDAAKOXAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

[0427] Where ψ denotes an non-native amino acid residue consisting of a cysteine that is carboxymethylated at the sulfhydryl group, and where Kox denotes a non-native lysine that is chemically modified at the ε-amino group with an oxime linker group coupled to a designated water-soluble polymer through ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular weightaaaaaaaaaa
molecular weightaaaaaaaaaa
molecular weightaaaaaaaaaa
Login to View More

Abstract

The present invention relates to methods and compositions for modifying peptides, polypeptides and proteins with polymers, especially glyco-mimetic polymers, so as to improve their biological activity or pharmacokinetic properties. The invention further provides methods and uses for such polymer-modified peptides, polypeptides and proteins. The invention is particularly suitable for use in the synthesis of polymer-modified, synthetic bioactive proteins, and of pharmaceutical compositions that contain such proteins.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS [0001] This application is a continuation of U.S. patent application Ser. No. 10 / 332,385 (filed Jan. 8, 2003), which is a national state application of PCT / US01 / 21930 (filed Jul. 12, 2001), and claims priority to U.S. Patent Applications Ser. Nos. 60 / 231,339 (filed Sep. 8, 2000) and 60 / 236,377 (filed Sep. 29, 2000), all of which applications are herein incorporated by reference in their entirety.FIELD OF THE INVENTION [0002] The present invention relates to methods and compositions for modifying biologically active synthetic peptides, polypeptides and proteins with polymers, especially glyco-mimetic polymers so as to improve their biological activity or pharmacokinetic properties. The invention further provides methods and uses for such polymer-modified peptides, polypeptides and proteins. BACKGROUND OF THE INVENTION [0003] Over the past 30 years, medical attention has increasingly turned to the possibility of using proteins as therapeutic dru...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(United States)
IPC IPC(8): A61K38/19A61K38/20C07K14/52C07K14/53C07K14/54C07K14/56C07H21/04C12P21/02C07K1/107
CPCC07K1/1077C12P21/02C07K14/52
InventorKOCHENDOERFER, GERDBOTTIBRADBURNE, JAMESCHEN, SHIAH -YUNCRESSMAN, SONYAHUNTER, CHRISTIEKENT, STEPHENLOW, DONALDWILKEN, JILL
OwnerAMYLIN PHARMA INC