Injection of serine protease inhibitor

A technology of serine protease and injection, applied in the field of biopharmaceuticals

Active Publication Date: 2016-08-24
GRAND LIFE SCI (LIAONING) CO LTD
View PDF3 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, in December 2007, according to the test data reported by the National Adverse Drug Reaction Monitoring Center, aprotinin injection can cause allergies, shock, palpitations, chest tightness, dyspnea, fever, vomiting, etc., so it was withdrawn from the market

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Injection of serine protease inhibitor
  • Injection of serine protease inhibitor
  • Injection of serine protease inhibitor

Examples

Experimental program
Comparison scheme
Effect test

Embodiment

[0041] Example 1 Preparation of Recombinant textilinin-1

[0042] Recombinant textilinin-1 involved in this patent is a recombinant protein, which is prepared by the method disclosed in the patent application number 201110178605.6. The specific preparation method is as follows:

[0043] The amino acid sequence of Recombinant textilinin-1 involved in the present invention is: SEQ NO 1: KDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA.

[0044] The artificially synthesized textilinin-1 structural gene is obtained by secreting and expressing a large amount of it in Pichia pastoris. According to the natural amino acid sequence of textilinin-1, the preferred codon of methanolic yeast is selected to artificially synthesize textilinin-1 Structural gene sequence, the gene sequence is: SEQ NO 2: AAG GAT AGA CCA GAT TTT TGT GAA TTG CCA GCT GAT ACT GGT CCA TGT AGA GTT AGA TTT CCA TCT TTT TAC TAC AAC CCA GAT GAA AAG AAG TGT TTG GAA TTT ATT TAC GGT GGT TGT GAA GGT AAC GCT AA...

Embodiment 4

[0057] Example 4 Selection of pH and concentration range of suitable buffer system for Recombinant textilinin-1

[0058] (1) Screening of the pH of the applicable buffer system

[0059] Randomly select the Recombinant textilinin-1 concentrate produced by Liaoning Nuokang Biopharmaceutical Co., Ltd., and use 50mmol / L Tris-HCl or 50mmol / L Na 2 HPO 4 -NaH 2 PO 4 Phosphate is prepared into diluent (the preparation method of Tris-HCl buffer solution and phosphate buffer saline solution is as shown in Table 2), draws the Recombinant textilinin-1 dilution solution to be tested and is placed in cuvette for activity measurement, the results are shown in figure 2 .

[0060] Table 2 Preparation of Tris-HCl buffer and phosphate buffer

[0061]

[0062]

[0063] like image 3 As shown, the relative enzyme activity of Recombinant textilinin-1 is affected by the pH value of the buffer, wherein, when the pH of Tris-HCl buffer is 7.2-7.8, Recombinant textilinin-1 has a higher e...

Embodiment 5

[0067] Example5 Effects of Anions on the Stability of Recombinant textilinin-1

[0068] (1) Effect of anion species on the stability of Recombinant textilinin-1

[0069] Take different kinds of anions and dilute them with 50mmol / L Tris-HCl diluent of pH 7.4 so that 1mg / ml Recombinant textilinin-1 contains 50mmol / L anions, and place them at a temperature of 60°C for about 18 hours, Measure again, dilute in 1ml reaction system, make Recombinant textilinin-1 reaction final concentration be 5nmol / L, carry out activity measurement in ultraviolet spectrophotometer, the Recombinant textiliinin-1 of different anions measures activity respectively before and after heating, this Recombinant The relative enzyme activity of textilinin-1 is the ratio of the activity of the same kind of anion after heating to the activity before heating. In order to remove the influence of anions on plasmin, measure the activity of plasmin with the same concentration of anions, the blank is the diluent, ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
concentrationaaaaaaaaaa
Login to View More

Abstract

The invention provides an injection of a serine protease inhibitor. The injection contains 0.05mg / ml to 30mg / ml of the serine protease inhibitor recombinant textilinin-1, a pH buffering agent, a surfactant, polyalcohol, amino acid and a bacteriostatic agent. The injection of the serine protease inhibitor has the advantages that the stability of protein medicine is improved; the preparation process is simple; the fibrinolysis-resistant treatment effect is good; and the injection can be used for treating and preventing fibrinolysis hyperfunction hemorrhage and blood loss caused by various reasons in clinics.

Description

technical field [0001] The invention relates to the field of biopharmaceuticals, in particular to an injection of a serine protease inhibitor. Background technique [0002] Textilinin-1 is an active protein extracted from the Australian brown snake Pseudonaja textilis textilis. Textililinin-1 is a Kunitz-type serine protease inhibitor, containing 59 amino acids, 3 pairs of disulfide bonds, and a molecular weight of about 6.7kDa. The Recombinant textilinin-1 used in the present invention is a recombinant protein of Textilinin-1 obtained from Pichia pastoris as an expression system. [0003] Serine protease inhibitors are widely found in animals, plants, and microorganisms, and can precisely regulate protease activity. Bovine trypsin inhibitor (BPTI), as the first discovered Kunitz-type protease inhibitory molecule, is a classic representative of this protein family. Aprotinin is a protein extracted from bovine lung that has the same sequence as BPTI, and is the main compon...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): A61K38/57A61K47/18A61K47/22A61K47/20A61K9/08A61P7/04
Inventor徐梅李娜李秀娜王振宇陈宏超薛雁王宏英薛百忠
OwnerGRAND LIFE SCI (LIAONING) CO LTD