Landscape fertilizer and preparation method thereof
A chemical fertilizer and gardening technology, applied in the direction of nitrogen fertilizer, potassium fertilizer, organic fertilizer, etc., can solve the problems of easy loss of fertilizer nutrients, low fertilizer utilization rate, insufficient fertilizer application, etc., to improve soil minerals and biologically active nutrients, fertilization Convenience, effect of improving physical and chemical properties
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0018] A garden chemical fertilizer, which consists of the following components and parts by weight: 5 parts of calcium, 10 parts of potassium, 1.5 parts of zinc, 1.7 parts of iron, 2 parts of magnesium, 0.6 parts of copper, 0.4 parts of manganese, 0.03 parts of cobalt, 0.07 parts of iodine, 0.06 parts of selenium, 0.01 parts of molybdenum, 0.01 parts of chromium, 38 parts of peptone, 0.35 parts of functional polypeptide, 18 parts of urea, 2 parts of anti-caking agent, 2 parts of water-retaining agent, and 38 parts of water. Nutritional value can promote the growth of plants, meet the nutritional needs of plants at all stages of growth, improve the quality and survival of plants, improve the use of nutrients by plants, improve fertilizer efficiency, adjust soil pH, and improve soil water retention capacity.
[0019] The amino acid sequence of the functional polypeptide in the chemical fertilizer formula is HSHACASYYFCGTACAKCGTASCTHYLSCHYLCRVLHPGKCACVNCSR. This functional polype...
Embodiment 2
[0027] A garden chemical fertilizer, which consists of the following components and parts by weight: 5 parts of calcium, 10 parts of potassium, 1 part of zinc, 1.6 parts of iron, 2 parts of magnesium, 0.5 parts of copper, 0.4 parts of manganese, 0.03 parts of cobalt, 0.06 parts of iodine, 0.08 parts of selenium, 0.01 parts of molybdenum, 0.01 parts of chromium, 38 parts of peptone, 0.34 parts of functional polypeptide, 22 parts of urea, 2 parts of anti-caking agent, 2 parts of water-retaining agent, and 34 parts of water. Nutritional value can promote the growth of plants, meet the nutritional needs of plants at all stages of growth, improve the quality and survival of plants, improve the use of nutrients by plants, improve fertilizer efficiency, adjust soil pH, and improve soil water retention capacity.
[0028]The amino acid sequence of the functional polypeptide in the chemical fertilizer formula is HSHACASYYFCGTACAKCGTASCTHYLSCHYLCRVLHPGKCACVNCSR. This functional polypeptid...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More