Unlock instant, AI-driven research and patent intelligence for your innovation.

Landscape fertilizer and preparation method thereof

A chemical fertilizer and gardening technology, applied in the direction of nitrogen fertilizer, potassium fertilizer, organic fertilizer, etc., can solve the problems of easy loss of fertilizer nutrients, low fertilizer utilization rate, insufficient fertilizer application, etc., to improve soil minerals and biologically active nutrients, fertilization Convenience, effect of improving physical and chemical properties

Inactive Publication Date: 2017-09-15
兰溪市奥而特农业科技有限公司
View PDF4 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] The object of the present invention is a kind of garden chemical fertilizer and preparation method thereof, to overcome defects such as insufficient amount of fertilization in the prior art, easy loss of fertilizer nutrient components, low fertilizer utilization rate, difficult caking during the storage of chemical fertilizer, adjustment of soil pH value, nutrition Rich in ingredients, it greatly improves the water retention capacity of the soil

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0018] A garden chemical fertilizer, which consists of the following components and parts by weight: 5 parts of calcium, 10 parts of potassium, 1.5 parts of zinc, 1.7 parts of iron, 2 parts of magnesium, 0.6 parts of copper, 0.4 parts of manganese, 0.03 parts of cobalt, 0.07 parts of iodine, 0.06 parts of selenium, 0.01 parts of molybdenum, 0.01 parts of chromium, 38 parts of peptone, 0.35 parts of functional polypeptide, 18 parts of urea, 2 parts of anti-caking agent, 2 parts of water-retaining agent, and 38 parts of water. Nutritional value can promote the growth of plants, meet the nutritional needs of plants at all stages of growth, improve the quality and survival of plants, improve the use of nutrients by plants, improve fertilizer efficiency, adjust soil pH, and improve soil water retention capacity.

[0019] The amino acid sequence of the functional polypeptide in the chemical fertilizer formula is HSHACASYYFCGTACAKCGTASCTHYLSCHYLCRVLHPGKCACVNCSR. This functional polype...

Embodiment 2

[0027] A garden chemical fertilizer, which consists of the following components and parts by weight: 5 parts of calcium, 10 parts of potassium, 1 part of zinc, 1.6 parts of iron, 2 parts of magnesium, 0.5 parts of copper, 0.4 parts of manganese, 0.03 parts of cobalt, 0.06 parts of iodine, 0.08 parts of selenium, 0.01 parts of molybdenum, 0.01 parts of chromium, 38 parts of peptone, 0.34 parts of functional polypeptide, 22 parts of urea, 2 parts of anti-caking agent, 2 parts of water-retaining agent, and 34 parts of water. Nutritional value can promote the growth of plants, meet the nutritional needs of plants at all stages of growth, improve the quality and survival of plants, improve the use of nutrients by plants, improve fertilizer efficiency, adjust soil pH, and improve soil water retention capacity.

[0028]The amino acid sequence of the functional polypeptide in the chemical fertilizer formula is HSHACASYYFCGTACAKCGTASCTHYLSCHYLCRVLHPGKCACVNCSR. This functional polypeptid...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a landscape fertilizer which is composed of the following components in parts by weight: 4-7 parts of calcium, 8-12 parts of potassium, 1-2.5 parts of zinc, 1.5-2 parts of iron, 1-3 parts of magnesium, 0.3-1 part of copper, 0.2-0.5 part of manganese, 0.02-0.05 part of cobalt, 0.03-0.1 part of iodine, 0.01-0.05 part of selenium, 0.008-0.02 part of molybdenum, 0.008-0.015 part of chromium, 35-45 parts of peptone, 0.3-0.4 part of functional polypeptide, 10-30 parts of urea, 1-3 parts of an anti-blocking agent, 1-3 parts of a water-retaining agent and 20-60 parts of water. The invention further discloses a preparation method of the fertilizer. According to the fertilizer disclosed by the invention, nutritive values of organic protein fertilizers and metal elements are combined, growth of plants can be promoted, the nutritional requirements at various phases of plant growth are met, the quality and survival quantity of plants are improved, the utilization effect of plants on nutrients is improved, and the fertilizer efficiency is improved.

Description

technical field [0001] The invention relates to a chemical fertilizer, in particular to a garden chemical fertilizer and a preparation method thereof. Background technique [0002] At present, chemical fertilizers are more and more widely used in garden cultivation, and fertilizers can supply various nutrients needed by garden plants. At the same time, improving the soil environment: physical properties, chemical properties and living conditions of microorganisms can also increase the utilization rate of fertilizers. Usually in the process of fertilization, the pH of the soil is ignored, which often leads to the immobilization of various nutrients such as calcium, iron, zinc, manganese, etc., and the fertilizer utilization rate is low. [0003] Prior art such as, Chinese Invention Authorized Patent Literature, Authorized Notice No. CN104030755B This invention relates to the technical field of chemical fertilizers for garden cultivation. It discloses a special chemical ferti...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C05G3/00C05G3/04C05G3/06C05G3/70C05G3/80
CPCC05C9/00C05G3/00C05G3/20C05G3/70C05G3/80C05D1/00C05D9/00C05D9/02C05F11/00
Inventor 郭婷婷
Owner 兰溪市奥而特农业科技有限公司