Polysaccharide extracted from monopterus albus fishskins
A fish skin and polysaccharide technology, applied in the field of polysaccharide extraction, to achieve the effect of easy absorption, high purity, and improved yield
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0016] The polysaccharide extracted from eel skin, the polysaccharide extraction steps are as follows: pretreatment; cell crushing; polysaccharide extraction; polysaccharide column chromatography; freeze-drying, the specific operation steps are as follows:
[0017] 1) Pretreatment: Take fresh eel skin, dry it, crush it, pass through a 48-mesh sieve, degrease with petroleum ether, and obtain defatted eel skin powder;
[0018] 2) The cell crushing step is: take the fish skin powder and sieve it to make a solution with a solid-to-liquid ratio of 1:14 and add 0.4% of the fish skin weight active polypeptide. The amino acid sequence of the active polypeptide is: HSHACASYYCSKFAACGTAHYSSCTHYPGKLCACVNCSR, and the pH of the sodium phosphate buffer =6.6 As an extractant, freeze-thaw three times at -20°C and 37°C, 3 hours each time, gradient ultrasonic assisted freeze-thaw, ultrasonic power 450w, time 12min, ultrasonic power increased 18w every 6min, until repeated freezing After melting,...
Embodiment 2
[0023] The polysaccharide extracted from eel skin, the polysaccharide extraction steps are as follows: pretreatment; cell disruption; polysaccharide extraction; polysaccharide column chromatography; freeze-drying, the specific preferred operation steps are as follows:
[0024] 1) Pretreatment: Take fresh eel skin, dry it, crush it, pass it through a 50-mesh sieve, and degrease with petroleum ether to obtain defatted eel skin powder;
[0025] 2) The cell crushing step is: take fish skin powder and sieve it to make a solution with a solid-to-liquid ratio of 1:12 and add 0.5% fish skin weight active polypeptide. The amino acid sequence of the active polypeptide is: HSHACASYYCSKFAACGTAHYSSCTHYPGKLCACVNCSR, using sodium phosphate buffer pH =6.7 As an extractant, at -20°C and 37°C, freeze-thaw 4 times, 3 hours each time, gradient ultrasonic assisted freeze-thaw, ultrasonic power 600w, time 14min, ultrasonic power increased 15w every 8min, until repeated freezing After melting, centr...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More