Polysaccharide extracted from monopterus albus fishskins

A fish skin and polysaccharide technology, applied in the field of polysaccharide extraction, to achieve the effect of easy absorption, high purity, and improved yield

Inactive Publication Date: 2017-12-26
浦江县欧立生物技术有限公司
View PDF2 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0003] The epidermis of eel is rich in polysaccharides, eel polysaccharides have good anti-oxidation, free radical scavenging, anti-tumor, anti-virus, hypoglycemic, hypolipidemic and other effects, and its extraction method has not been reported yet

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0016] The polysaccharide extracted from eel skin, the polysaccharide extraction steps are as follows: pretreatment; cell crushing; polysaccharide extraction; polysaccharide column chromatography; freeze-drying, the specific operation steps are as follows:

[0017] 1) Pretreatment: Take fresh eel skin, dry it, crush it, pass through a 48-mesh sieve, degrease with petroleum ether, and obtain defatted eel skin powder;

[0018] 2) The cell crushing step is: take the fish skin powder and sieve it to make a solution with a solid-to-liquid ratio of 1:14 and add 0.4% of the fish skin weight active polypeptide. The amino acid sequence of the active polypeptide is: HSHACASYYCSKFAACGTAHYSSCTHYPGKLCACVNCSR, and the pH of the sodium phosphate buffer =6.6 As an extractant, freeze-thaw three times at -20°C and 37°C, 3 hours each time, gradient ultrasonic assisted freeze-thaw, ultrasonic power 450w, time 12min, ultrasonic power increased 18w every 6min, until repeated freezing After melting,...

Embodiment 2

[0023] The polysaccharide extracted from eel skin, the polysaccharide extraction steps are as follows: pretreatment; cell disruption; polysaccharide extraction; polysaccharide column chromatography; freeze-drying, the specific preferred operation steps are as follows:

[0024] 1) Pretreatment: Take fresh eel skin, dry it, crush it, pass it through a 50-mesh sieve, and degrease with petroleum ether to obtain defatted eel skin powder;

[0025] 2) The cell crushing step is: take fish skin powder and sieve it to make a solution with a solid-to-liquid ratio of 1:12 and add 0.5% fish skin weight active polypeptide. The amino acid sequence of the active polypeptide is: HSHACASYYCSKFAACGTAHYSSCTHYPGKLCACVNCSR, using sodium phosphate buffer pH =6.7 As an extractant, at -20°C and 37°C, freeze-thaw 4 times, 3 hours each time, gradient ultrasonic assisted freeze-thaw, ultrasonic power 600w, time 14min, ultrasonic power increased 15w every 8min, until repeated freezing After melting, centr...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention discloses a polysaccharide extracted from monopterus albus fishskins, and belongs to the technical field of polysaccharide extraction. The extraction of the fishskin polysaccharide comprises the following steps: pretreatment; cell crushing; polysaccharide extraction; polysaccharide column chromatography; and lyophilization. According to the invention, an active polypeptide and a repeated freezing-thawing method are utilized, thus fishskin cell walls are crushed, and a yield of the polysaccharide is improved; and through separation and purification, purity of the polysaccharide is further improved, and the extracted polysaccharide has a low molecular weight, and remarkable effects on blood glucose reduction and blood fat reduction, and is easily absorbed by people.

Description

technical field [0001] The invention belongs to the technical field of polysaccharide extraction, and in particular relates to a polysaccharide extracted from eel skin. Background technique [0002] Rice field eel is not only a delicacy on the table, but its meat, blood, head and skin all have certain medicinal value. According to the "Compendium of Materia Medica", rice field eel has the effects of nourishing blood, nourishing qi, reducing inflammation, disinfecting, and removing rheumatism. Rice field eel meat is sweet and warm in nature and has the effect of tonifying the middle and benefiting the blood, and curing deficiency. It is used in folk medicine to treat diseases such as consumptive cough, damp-heat itching, hemorrhoids, intestinal wind and hemorrhoids, and deafness. Traditional Chinese medicine believes that it has health care functions such as invigorating qi and nourishing blood, warming yang and invigorating the spleen, nourishing the liver and kidney, and d...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C08B37/00
CPCC08B37/0003C08B37/00
Inventor 李冰
Owner 浦江县欧立生物技术有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap