Unlock instant, AI-driven research and patent intelligence for your innovation.

Low-molecular-weight kelp fucoidin

A technology of kelp, fucoidan, and low molecular weight, which is applied in the field of polysaccharide extraction to achieve the effects of high polysaccharide yield, increased polysaccharide degradation degree, and increased polysaccharide yield

Inactive Publication Date: 2018-01-12
磐安县派普特生物科技有限公司
View PDF5 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In this invention, fucoidan is recovered from waste water by using green and environment-friendly ionic liquid. The amount of ionic liquid is small and can be reused. The amount of ethanol used in the recovery process is very small, which avoids the use of a large amount of ethanol in the prior art. The disadvantage of precipitating fucoidan, thus reducing the production cost, but the polysaccharide yield of this method still has room for further improvement

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0015] A kind of low molecular weight kelp fucoidan, the preparation steps of fucoidan include: cell wall crushing; polysaccharide rough extraction; polysaccharide extraction and separation and purification, the specific operation steps are as follows:

[0016] 1) Cell wall crushing: take 29 parts of fucoidan powder and pass through a 54-mesh mesh sieve, soak in absolute ethanol to degrease, extract the solid residue with water at a ratio of 1:10m / V to solid, stir for 28min, seal and let stand for 3h, add active polypeptide, the active The amount of polypeptide added is 0.04% of the weight of the fucoidan powder. The amino acid sequence of the active polypeptide is: HSHACASYYCSKNFCHGSCTHSYLCRVLHPGKNCSR. Stir for 6 minutes, steam explosion treatment, pressure 2.2MPa, and maintain for 36s to obtain a cell disruption solution;

[0017] 2) Crude polysaccharide extraction: Add 10 parts of deionized water to the cell disruption solution, extract at 64°C for 2 hours, extract twice, co...

Embodiment 2

[0022] A low-molecular-weight kelp fucoidan. The preparation steps of the fucoidan include: cell wall crushing; polysaccharide crude extraction; polysaccharide extraction and separation and purification. The specific preferred operation steps are as follows:

[0023] 1) Cell wall crushing: Take 30 parts of fucoidan powder and pass through a 58-mesh mesh sieve, soak in absolute ethanol to degrease, extract the solid residue with water at a ratio of 1:8m / V to solid, stir for 30min, seal and let stand for 2h, add active polypeptide, and activate The amount of polypeptide added is 0.04% of the weight of the fucoidan powder, and the amino acid sequence of the active polypeptide is: HSHACASYYCSKNFCHGSCTHSYLCRVLHPGKNCSR. Stir for 6 minutes, steam explosion treatment, pressure 2.6MPa, and maintain for 36s to obtain cell disruption solution;

[0024] 2) Crude polysaccharide extraction: Add 10 parts of deionized water to the cell disruption solution, extract at 64°C for 2 hours, extract ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses low-molecular-weight kelp fucoidin and belongs to the technical field of extraction of polysaccharide. An extraction method of kelp fucoidin comprises the following steps: cellwall breakage, polysaccharide crude extraction, polysaccharide extraction, separation and purification, wherein the cell wall breakage step comprises the following sub-steps: taking 20-34 parts of fucus powder, performing soak degreasing on fucus powder in absolute ethyl alcohol, extracting solid residues with water at the liquor ratio of 1:(8-10) m / V, performing stirring for 20-35 min, performing sealing and standing for 2-4 h, adding active peptide, performing stirring for 5-8 min, performing steam explosion treatment at the pressure of 2-2.8 MPa, and keeping the pressure for 35-48 s to obtain a cell disruption liquid. The extracted polysaccharide is low in molecular weight, easy to absorb, and good in anti-tumor and health-care effect; the breakage rate of kelp fucoidin is increased through active peptide; the yield and the purity of polysaccharide are improved; and the polysaccharide preparation cost is low.

Description

technical field [0001] The invention belongs to the technical field of polysaccharide extraction, and in particular relates to a low molecular weight kelp fucoidan. Background technique [0002] my country is a big producer of kelp, and has become the largest producer of kelp in the world after decades of development. According to statistics, China's seaweed production has reached 1 million tons in 2009, of which kelp production accounts for more than 70% of the world's total production. It has become one of the important pillar industries of my country's marine economy and has huge social and economic benefits. Kelp is a nutrient-rich edible brown algae. Every 100g of kelp contains nutrients: 8.2g of protein, 56.2g of carbohydrates, 117mg of calcium, 150mg of iron, 25mg of iodine, and also contains carotene, thiamine, riboflavin, Niacin and other vitamins. Rich in nutrients, especially low in calories, medium in protein, and high in minerals, it has edible functions such...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C08B37/00A23L33/125
Inventor 陈雨诗
Owner 磐安县派普特生物科技有限公司