Lactobacillus plantarum for expressing mouse antibacterial peptide gene

A Lactobacillus plantarum and gene technology, applied in the field of genetic engineering, can solve the problems of inability to achieve intestinal targeted delivery and reduction of digestive tract enzymes, and achieve the effects of promoting healthy intestinal development, strong cellular immune response, and good industrial prospects.

Active Publication Date: 2020-06-26
JIANGNAN UNIV
View PDF6 Cites 5 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0005] The technical problem to be solved by the present invention is to overcome the defects in the prior art that oral CRAMP is easily reduced by digestive tract enzymes, unable to achieve intestinal targeted delivery of CRAMP, and maximize its local immune regulation effect, and to provide a recombinant protein that secretes and expresses CRAMP Lactobacillus plantarum and its application

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Lactobacillus plantarum for expressing mouse antibacterial peptide gene
  • Lactobacillus plantarum for expressing mouse antibacterial peptide gene
  • Lactobacillus plantarum for expressing mouse antibacterial peptide gene

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0059] Embodiment 1 Construction of recombinant plasmid pMG36e-CRAMP

[0060] (1) Codon preference optimization and synthesis of the gene sequence: According to the sequence of the target gene CRAMP gene and the characteristics of the expression vector pMG36e, the 108bp codon-optimized sequence of the CRAMP gene was sent to the company for synthesis by artificial synthesis. Xbal-CRAMP-F is an upstream primer containing the restriction site Xbal (TCTAGA) fused with pMG36e and the initial sequence of the 5' end of the signal peptide CRAMP, and CRAMP-Sph1-R is an upstream primer with a restriction site Sph1 (GCATGC ) CRAMP gene reverse primer. The optimally synthesized CRAMP sequence is shown in SEQ ID NO: 1; the optimally synthesized Xbal-CRAMP-F and CRAMP-Sph1-R primer sequences are shown in SEQ ID NO: 5-6, respectively.

[0061] (2) PCR amplification of CRAMP gene fragments: using the optimized synthesized CRAMP gene as a template, add high-fidelity DNA polymerase KOD-Plus-(1...

Embodiment 2

[0063] Example 2 Construction of recombinant plasmid pNZ8148-CRAMP

[0064](1) Codon preference optimization and synthesis of the gene sequence: According to the sequence of the target gene CRAMP gene and the characteristics of the expression vector pMG36e, the 108bp codon-optimized sequence of the CRAMP gene was sent to the company for synthesis by artificial synthesis. Sph1-CRAMP-F is an upstream primer containing the restriction site Sph1 (GCATGC) fused with pMG36e and the initial sequence of the 5' end of the signal peptide CRAMP, and CRAMP-Xbal-R is an upstream primer with restriction site Xbal (TCTAGA ) CRAMP gene reverse primer. The optimized and synthesized CRAMP sequence is shown in SEQ ID NO: 1; the optimized and synthesized Sph1-CRAMP-F and CRAMP-Xbal-R primer sequences are shown in SEQ ID NO: 7-8 respectively.

[0065] (2) PCR amplification of CRAMP gene fragments: using the optimized synthesized CRAMP gene as a template, add high-fidelity DNA polymerase KOD-Plus-...

Embodiment 3

[0067] Example 3 Construction of recombinant plasmid pMG36e-Usp45-Linker-CRAMP

[0068] (1) Codon preference optimization and synthesis of the gene sequence: According to the sequence of the target gene CRAMP gene and the characteristics of the expression vector pMG36e, and the signal peptide sequence Usp45 added for the purpose of efficient secretion and expression, artificially synthesized The 243bp codon-optimized sequence of the Usp45-Linker-CRAMP gene was sent to the company for synthesis. Xbal-Usp45-Linker-CRAMP-F is an upstream primer containing the first sequence of the 5' end of the restriction site Xbal fused with pMG36e and the signal peptide Usp45-Linker-CRAMP, and Usp45-Linker-CRAMP-Sph1-R is Signal peptide Usp45-Linker-CRAMP gene reverse primer. At the same time, primers pNZ1 and pNZ2 for PCR detection and sequencing of recombinant plasmids were also designed, which were designed based on the region of about 70-90 bp upstream and downstream of the MCS of pMG36e ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention provides lactobacillus plantarum for expressing a mouse antibacterial peptide gene, and belongs to the technical field of genetic engineering. The lactobacillus plantarum optimizes the nucleotide sequence of CRAMP protein, and can promote the secretory expression of the CRAMP gene in combination with Usp45 signal peptide, so that a lactobacillus expression system becomes a food-gradeexpression system, and can be taken together with thalli. The recombinant lactobacillus plantarum can be used as a novel oral vaccine product with a good industrial prospect, plays a positive role inrelieving intestinal inflammation, and has important practical significance for promoting the healthy development of intestinal tracts.

Description

technical field [0001] The invention relates to a plant lactobacillus expressing a mouse antimicrobial peptide gene, which belongs to the technical field of genetic engineering. Background technique [0002] Antimicrobial peptides are major components of innate immunity and defenses in a variety of hosts including plants, invertebrates, and vertebrates, including humans. Cathelicidins are a major class of antimicrobial peptides characterized by a conserved anionic N-terminal precursor sequence called cathelin. The conservation of the cathelin sequence suggests that various members of the family evolved from duplication and modification of a common ancestral gene. CRAMP (Cathelicidin-Related AntiMicrobial Peptide) contains 34 amino acids (GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ), which has strong antibacterial activity against Gram-positive and Gram-negative bacteria, but has no hemolytic activity against human red blood cells. 1 mM CRAMP can directly lead to immediate permeabil...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/47C12N15/12C12N1/21C12N15/74A23L33/135A61K39/02A61P31/04A61P1/00C12R1/25
CPCC07K14/47C12N15/746A23L33/135A61K39/09A61P31/04A61P1/00A23V2002/00A61K2039/542A23V2400/169A23V2200/3204
Inventor 孙嘉潘礼龙张明陈卫张灏
Owner JIANGNAN UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap