Application of enc002 and its analogs in the treatment or prevention of enterovirus infection
A technology for enterovirus and hand, foot and mouth disease virus, which can be applied in antiviral agents, medical preparations containing active ingredients, and drug combinations, etc., and can solve problems such as increasing the complexity and difficulty of hand, foot and mouth disease.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0065] Example 1. Screening of small molecule compounds with anti-enterovirus activity
[0066] Based on structural biology combined with supercomputer analysis, a new target 3A protein was selected to screen small molecule compounds in the marketed drug library (Aprroved), natural product library and InterBioScreen library. The virtual screening strategy refers to the screening method described in the literature "Computational protein–ligand docking and virtual drug screening with the AutoDock suite. Nature Protocols, 2016". The amino acid sequence of the 3A protein is as follows: GPPKFRPIRISLEEKPAPDAISDLLASVDSEEVRQYCREQGWIIPETPTNVERHLNRAVLVMQSIATVVAVVSLVYVIYKLFAGFQ. The compound ENC002 (compound number in this laboratory) was screened, its CAS number is 849018-64-0, and its molecular formula is C 23 H 18 ON 4 , the structure is as figure 1 shown.
Embodiment 2
[0067] Example 2. Pharmacodynamic detection of compound ENC002 on human enterovirus
[0068] 1. Cell culture, amplification and purification of EV-A71 virus
[0069] RD cells were cultured in DMEM medium containing 10% FBS. When the number of cells is sufficient, they are divided into 10 cm dishes at a density of 70%. Incubate in a 37°C carbon dioxide incubator. 24 hours later, EV-A71 virus was diluted with DMEM medium, the medium in the cell culture dish was discarded, 4 ml of virus dilution was added to each dish of cells, and EV-A71 virus was inoculated at MOI=1. After adsorption at 37°C for 1 hour, the supernatant was discarded, and 10 ml of DMEM medium containing 5% FBS was added. Incubate at 37°C for 48 hours, and observe whether the cells reach 50% shedding. The supernatant was collected and centrifuged at 2000 rpm for 10 minutes. Take the supernatant. 5×PEG8000 NaCl solution was prepared and sterilized by autoclaving at 121°C for 30 minutes. After cooling at room...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More