205 results about "Myocarditis" patented technology

Porcine circovirus-2 (PCV-2) is a recently identified agent wherein the potential spectrum of PCV-2-associated disease has been expanded by evidence of vertical and sexual transmission and associated reproductive failure in swine populations. PCV-2 was isolated from a litter of aborted piglets from a farm experiencing late term abortions and stillbirths. Severe, diffuse myocarditis was present in one piglet associated with extensive immunohistochemical staining for PCV-2 antigen. Variable amounts of PCV-2 antigen were also present in liver, lung and kidney of multiple fetuses. Inoculation of female pigs with a composition including an immunogen from PCV-2 or an epitope of interest from such an immunogen or with a vector expressing such an immunogen or epitope of interest prior to breeding, such as within the first five weeks of life, or prior to the perinatal period, or repeatedly over a lifetime, or during pregnancy, such as between the 6th and 8th and / or the 10th and 13th weeks of gestation, can prevent myocarditis, abortion and intrauterine infection associated with porcine circovirus-2. In addition, innoculation of male and / or female pigs with the aforementioned compositions can be carried out to prevent transmission of PCV-2 from male to female (or vice versa) during mating. Thus, the invention involves methods and compositions for preventing myocarditis, abortion and intrauterine infection associated with porcine circovirus-2.

Porcine circovirus-2 (PCV-2) is a recently identified agent wherein the potential spectrum of PCV-2-associated disease has been expanded by evidence of vertical and sexual transmission and associated reproductive failure in swine populations. PCV-2 was isolated from a litter of aborted piglets from a farm experiencing late term abortions and stillbirths. Severe, diffuse myocarditis was present in one piglet associated with extensive immunohistochemical staining for PCV-2 antigen. Variable amounts of PCV-2 antigen were also present in liver, lung and kidney of multiple fetuses. Inoculation of female pigs with a composition including an immunogen from PCV-2 or an epitope of interest from such an immunogen or with a vector expressing such an immunogen or epitope of interest prior to breeding, such as within the first five weeks of life, or prior to the perinatal period, or repeatedly over a lifetime, or during pregnancy, such as between the 6and 8and / or the 10and 13weeks of gestation, can lower viral titer, prevent myocarditis, abortion and intrauterine infection associated with porcine circovirus-2. In addition, innoculation of male and / or female pigs with the aforementioned compositions can be carried out to prevent transmission of PCV-2 from male to female (or vice versa) during mating. Thus, the invention involves methods and compositions for preventing myocarditis, abortion and intrauterine infection associated with porcine circovirus-2.

Methods are provided for reducing copper values for, by way of example, treating, preventing or ameliorating tissue damage such as, for example, tissue damage that may be caused by (i) disorders of the heart muscle (for example, cardiomyopathy or myocarditis) such as idiopathic cardiomyopathy, metabolic cardiomyopathy which includes diabetic cardiomyopathy, alcoholic cardiomyopathy, drug-induced cardiomyopathy, ischemic cardiomyopathy, and hypertensive cardiomyopathy, (ii) atheromatous disorders of the major blood vessels (macrovascular disease) such as the aorta, the coronary arteries, the carotid arteries, the cerebrovascular arteries, the renal arteries, the iliac arteries, the femoral arteries, and the popliteal arteries, (iii) toxic, drug-induced, and metabolic (including hypertensive and / or diabetic disorders of small blood vessels (microvascular disease) such as the retinal arterioles, the glomerular arterioles, the vasa nervorum, cardiac arterioles, and associated capillary beds of the eye, the kidney, the heart, and the central and peripheral nervous systems, (iv) plaque rupture of atheromatous lesions of major blood vessels such as the aorta, the coronary arteries, the carotid arteries, the cerebrovascular arteries, the renal arteries, the iliac arteries, the fermoral arteries and the popliteal arteries, (v) diabetes or the complications of diabetes.

Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

The invention includes processes mainly for the treatment of a inflammatory diseases, such as inflammatory bowel disease, arthritis, atherosclerosis, asthma, allergy, inflammatory kidney disease, circulatory shock, multiple sclerosis, chronic obstructive pulmonary disease, skin inflammation, periodontal disease, psoriasis and T cell-mediated diseases of immunity, including allergic encephalomyelitis, allergic neuritis, transplant allograft rejection, graft versus host disease, myocarditis, thyroiditis, nephritis, systemic lupus erthematosus, and insulin-dependent diabetes mellitus. The processes involve treating a patient with a pharmaceutical composition containing an active ingredient that inhibits the activity of sphingosine kinase.

The invention provides among other things methods and kits based on assaying for cardiac troponin autoantibodies, either in conjunction with an assay for cardiac troponin and / or as an independent indicator of cardiac pathology, such as myocarditis, cardiomyopathy, and / or ischemic heart disease. Assay methods of the invention can be employed among other things to identify cardiac pathology, or risk thereof, in subjects who have an autoimmune disease or who are related to an individual with an autoimmune disease. In particular embodiments, the invention also provides a method of determining whether a subject having, or at risk for, a cardiac pathology is a candidate for immunosuppressive therapy or immunoabsorption therapy. The invention also provides kits and kit components that are useful for performing the methods of the invention.

The invention relates to a medical examination and diagnosis method and instrument, in particular to a multi-dimensional electrocardio ultrasonic signal fusion computed tomography imaging system and method based on anatomical orientation. A multi-dimensional ultrasonic cardiac structure and a perfusion image technology are further integrated on the basis of a multi-dimensional electrocardiosignal imaging system and method, and a novel non-invasive platform is provided for recording and evaluating the electro-mechanical signal characteristic and myocardial perfusion characteristic of heart. The method is a unique electrocardio-mechanical function and perfusion synchronized computed tomography imaging method based on anatomical orientation, and the technology is a non-invasive imaging technology for detecting transmural cardiac electrical activity information and mechanical signals. By adopting the medical examination and diagnosis method and instrument, the diagnosis of myocardial diseases such as cardiac hypertrophy, cardiomyopathy, myocardial infarction and myocarditis, the determination of the origin of arrhythmia, and the like can be enhanced, and a brand-new diagnosis and guide treatment tool is provided for rapid real-time diagnosis of heart diseases.

The invention provides among other things methods and kits based on assaying for cardiac troponin autoantibodies, either in conjunction with an assay for cardiac troponin and / or as an independent indicator of cardiac pathology, such as myocarditis, cardiomyopathy, and / or ischemic heart disease. Assay methods of the invention can be employed among other things to identify cardiac pathology, or risk thereof, in subjects who have an autoimmune disease or who are related to an individual with an autoimmune disease. In particular embodiments, the invention also provides a method of determining whether a subject having, or at risk for, a cardiac pathology is a candidate for immunosuppressive therapy or immunoabsorption therapy. The invention also provides kits and kit components that are useful for performing the methods of the invention.

A compound of formula (I) wherein R<1> and R<2> are as defined in the description, R<2> being an aromatic group, useful in the treatment and condition selected from the group consisting of the group meningitis and salpingitis, septic shock, disseminated intravascular coagulation, and / or adult respiratory distress syndrome, acute or chronic inflammation, arthritis, cholangitis, colitis, encephalitis, endocarditis, glomerulonephritis, hepatitis, myocarditis, pancreatitis, pericarditis, reperfusion injury, vasculitis, acute and delayed hypersensitivity, graft rejection, and graft-versus-host disease, auto-immune diseases including Type 1 diabetes mellitus and multiple sclerosis, periodonate diseases, interstitial pulmonary fibrosis, cirrhosis, systemic sclerosis, keloid formation tumors which produce IL-1 as an autocrine growth factor, cachexia, Alzeimer's disease, percussion injury, depression, atherosclerosis, osteoporosis in a mammal, including a human.

Molecular signatures that function as very sensitive diagnostic biomarker for myocarditis, heart disease and disorders thereof, are identified.

The invention relates to medical examination and diagnosis methods and instruments, in particular to a multi-dimensional electrocardiosignal imaging system and method. The body surface electric potential mapping technology and the electrocardio vector technology are integrated, a new non-invasive platform is provided for recording the heart-across-myocardium electrical activity information, and in other words, a new non-invasive body surface heart-across-myocardium electrical activity information imaging method and technology which are formed by combining the vector center 0 point galvanic coupling and body surface electric potential mapping technology and are similar to satellite positioning are provided. The non-invasive electrocardio function imaging method and technology for detecting heart-across-myocardium electrocardio activity information with the dissection positioning as a basis are provided. According to the multi-dimensional electrocardiosignal imaging system and method, the arrhythmia reason can be determined, the cardiac muscle diseases such as myocardial hypertrophy, cardiomyopathy, myocardial infarction and myocarditis can be diagnosed, and a brand new diagnosis tool is provided for fast diagnosing the heat diseases in real time.

The invention discloses compounds having virus resistance and a composition thereof. The composition comprises one or more of the 13 compounds comprising 6'-O-caffeoyl deacetyl asperulosidic acid methyl ester. The compounds having virus resistance and the composition thereof can be extracted from plants and can also be prepared by synthesis. The composition comprising the compounds having virus resistance can prevent and treat viral infection-caused diseases such as influenza, myocarditis, conjunctivitis, viral pneumonia, encephalitis, leukemia, hepatitis B, hepatitis C, AIDS, genitourinary system infection, EB virus infection, human papillomavirus infection and cytomegalovirus infection. The composition can be prepared into an oral preparation, an injection, a spray, a subcutaneous injection and an anus suppository.

The invention discloses Yang-freeing and Qi-boosting health-care tea, which is characterized in that the main ingredients comprise 15 to 30 grams of raw raidx astragali, 5 grams of liquoric root, 15 grams of codonopsis pilosula, 10 grams of cassia twig, 10 grams of ginseng and10 grams of mix-fried liquoric root; for treating the heart throb and knotted and intermittent pulse of patients with coronary heart disease, 10 grams of szechuan lovage rhizome, 20 grams of salvia miltiorrhiza bunge, 15 grams of raw keel, 15 grams of raw oyster, 15 grams of magnetitum, 40 grams of huai valleys grown wheat, 20 grams of pericarpium trichosanthis, 10 grams of turmeric root-tuber and 10 grams of orange fibers are added, or 10 grams of szechuan lovage rhizome, 20 grams of salvia miltiorrhiza bunge, 15 grams of raw keel, 15 grams of magnetitum and 40 grams of huai valleys grown wheat are added; for treating chest stuffiness and precardial pain, 20 grams of pericarpium trichosanthis, 10 grams of turmeric root-tuber, and 10 grams of orange fibers are added; for great pains, szechwan Chinaberry fruit which is raw medicament of Sichuan Chinaberry powder and corydalis yanhusuo W. T. Wang are semi-ground and taken with water for 2 to 3 times each day; for treating insomnia and dreaminess, spina date seed and platycladi seeds are added; for treating the heart throb of people with rheumatic heart disease, mulberry twig, gentiana macrophylla, turmeric and Chinese taxillus twig are added; and for treating the heart throb and chest stuffiness of people with myocarditis, lightyellow sophora root, salvia miltiorrhiza bunge, coastal glehnia root and the like are added. The preparation method comprises the following steps: mixing the medicaments; placing the mixture in a vessel and soaking the mixture in water for 25 minutes; decocting the mixture over a slow fire for 15 minutes; and obtaining about 200 milliliters of liquid to be taken in a day in two times.

The invention relates to an acrylamide compound with a structural formula I or an isomer thereof, a pharmaceutical salt thereof and a solvate thereof, and also relates to the compound or the isomer thereof or the pharmaceutical salt thereof and the solvate thereof, a composition of a pharmaceutically acceptable vector, an excipient or a diluent, and uses of the compound or the composition in preventing and / or treating diseases or symptoms which relate to cardiomyocyte apoptosis and include but are not limited to the uses of (i) treating hungry myocardial atrophy, (ii) treating myocarditis, (iii) treating cardiac failure, (iv) treating or relieving myocardial damage caused by essential hypertension, (v) treating or relieving myocardial damage caused by early-stage acute myocardial infarction, (vi) treating or relieving myocardial damage caused by acute myocardial infarction reperfusion, (vii) treating or relieving cardiomyocyte pathology caused by heart transplant, (viii) treating or relieving dysplastic cardiomyopathy, cardiomyocyte apoptosis caused by anoxia, or improving cardiovascular system sclerosis.

The invention relates to the pharmacy field, concretely relates to a use of a series of pentacyclic triterpene compounds as enterovirus EV71 inhibitors, and especially relates to an application in the preparation of medicines for preventing and treating EV71 infection induced hand-foot-and-mouth diseases and complications thereof, such as synanche, myocarditis, pulmonary edema, encephalitis, herpes, septicemia, hypertension, hyperglycemia, cognitive function disorder, poliomyelitis-like paralysis and many nerve system associated diseases. The invention also discloses medicinal compositions of the series of the pentacyclic triterpene compounds as enterovirus EV71 inhibitors.

The invention includes processes mainly for the treatment of a inflammatory diseases, such as inflammatory bowel disease, arthritis, atherosclerosis, asthma, allergy, inflammatory kidney disease, circulatory shock, multiple sclerosis, chronic obstructive pulmonary disease, skin inflammation, periodontal disease, psoriasis and T cell-mediated diseases of immunity, including allergic encephalomyelitis, allergic neuritis, transplant allograft rejection, graft versus host disease, myocarditis, thyroiditis, nephritis, systemic lupus erthematosus, and insulin-dependent diabetes mellitus. The processes involve treating a patient with a pharmaceutical composition containing an active ingredient that inhibits the activity of sphingosine kinase.

The invention discloses a potassium magnesium aspartate sterile powder injection and a method for preparing the same. The method is as follows: polyaspartate, magnesium oxide and potassium Hydroxide are prepared into a solution according to a certain method to obtain a liquid medicine, the liquid medicine is subject to reduced-pressure vacuum drying, solvent crystallization or spray drying, and is prepared into sterile packaged products for injection. The potassium magnesium aspartate sterile powder injection of the invention has the advantages of rapid redissolution, excellent stability, simple process, low production cost, suitability for industrial production, etc. the potassium magnesium aspartate sterile powder injection is mainly used for supplementing electrolyte, and can also be used for the treatment of hypokalemia and arrhythmia (mainly ventricular arrhythmia) caused by digitalism, and for the adjuvant treatment of myocarditis sequela, congestive heart failure, and miocardial infarction.

The invention discloses a preparation method of low-molecular chondroitin sulfate for treating myocarditis. The preparation method comprises the step of fermenting raw materials through arthrobacter sulfonivorans fermentation liquor, carrying out enzymolysis treatment on the chondroitin sulfate in the raw materials to obtain the low-molecular chondroitin sulfate, wherein the content of the chondroitin sulfate disaccharide in the prepared low-molecular chondroitin sulfate is more than 97%, the molecular weight of the chondroitin sulfate disaccharide is between 450-480, the chondroitin sulfate A content is between 70-95%, and the chondroitin sulfate C content is between 5-25%. The preparation method is convenient to operate, short in period and low in cost, the prepared low-molecular chondroitin sulfate is good in curative effect and high in purity, and can be applied to large-scale industrial production; the low-molecular chondroitin sulfate has obvious effect on myocardial cell injury repair through rat test.

The invention discloses a traditional Chinese medicine composition for treating myocarditis. The traditional Chinese medicine composition mainly comprises platycladi seeds, fructus forsythiae, astragalus, juncus effusus, safflower, cassia twig, radix ophiopogonis, radix curcumae, radix pseudostellariae, trichosanthis, lophatherum gracile, rhizoma arisaematis, radix glycyrrhizae preparate, cortex albiziae, shizandra and salvia miltiorrhiza. The traditional Chinese medicine composition has the effects of clearing away heat and toxic materials as well as warming the middle warmer and tonifying qi, has a favorable relaxation effect for symptoms such as chest distress, palpitate, dizzy giddy and short breath caused by myocarditis and has a remarkable therapeutic effect for myocarditis.

Disclosed is a Chinese medicament for treating heart diseases, which is prepared from astragalus root, pilose asiabell root, lilyturf root, prepared rehmannia root, poria with hostwood, dandelion, gypsum, pinellia tuber, thunberg fritillary bulb, baikal skullcap root, bamboo leaves, Chinese angelica root, polygala root, Arisaema cum Bile, cardamom, grassleaved sweetflag rhizome and licorice root.

The invention discloses an astragalus extract and a preparation method thereof and application. Astragalus is smashed, water is added to soak the astragalus, ultrasonic extraction and filtration are performed, and filtrate is taken; the filtrate is concentrated, ethanol is added to perform extraction three times, and the ethanol extraction concentrations are sequentially 50-55%, 65-75% and 90% or above. The filtrate filtered through ethanol extraction for the third time and filter residue are treated respectively, the filtrate undergoes impurity removal, and astragaloside extracting solution is obtained; the filter residue undergoes impurity removal to obtain astragalus polysaccharide extracting liquid; and the astragaloside extracting solution and the astragalus polysaccharide extracting liquid are combined to obtain the astragalus extract. The astragalus extract retains active ingredients of saponin and polysaccharide in astragalus and can be directly used for preparing medicines for treating myocarditis or is combined with other medicines to prepare the medicines for treating myocarditis.

Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

The invention relates to a method for preparing AS-605240 and an application thereof on medicines for treating inflammatory diseases. An improvement of the preparation method disclosed to the international patent is supplied to 5-quinoxaline methylene-2, 4-thiazolidinedione (AS-605240 with a structural formula I). 3, 4-diaminotoluene and glyoxal water solution as raw materials are relatively easy to obtain, reactive reagent, such as sodium bicarbonate, N-bromosuccinimide, carbon tetrachloride, and the like in each step is cheap and easy, and the reaction condition is mild. A great deal of mouse experimental curative effect observation of myocarditis, acute and chronic hepatitis, acute colitis and pancreatitis, which is induced by concanavalin A, is performed by the AS-605240, and the favorable curative effects of the AS-605240 are all confirmed. The prior TZDs, such as troglitazone, and the like are mainly used for aspects on treating diabetes mellitus, angiocardiopathy, and the like. In recent years, a study confirms that the AS-605240 protects the mouse joint and treats rheumatoid arthritis through restraining an osphatidylinositol 3 (PI3K) kinase gamma subtype signal way, therefore, the AS-605240 application on medicines for treating the inflammatory diseases opens up a new medical treatment field on the discovery of thiazolidinedione compound.

The invention discloses an application of a Semaphrin7A antibody in preparation of a drug for treating myocarditis disease, and also discloses the drug containing the Semaphrin7A antibody as an activeingredient for treating the myocarditis disease. In a myocarditis mouse model, a diseased mouse is treated with the Semaphrin7A antibody, myocardial cell inflammation can be relieved, and the survival rate of mice can be increased; the Semaphrin7A antibody has important application prospect and popularization value in research, development and production of the drug for treating the myocarditis.

The invention relates to a novel stable protein kinase activator adenosine cyclophosphate salt derivate, which has high storage stability and preparation performance and can be used in the preparation of medicaments for treating or preventing the following human and animal diseases such as stenocardia, cardiac failure, myocardial infarction, myocarditis, arrhythmia, cardiogenicshock, acute leukemia, nerve system diseases, respiratory system diseases, senile chronic bronchitis, hepatitis, psoriasis and the like and relieving the symptoms, such as cardiopalmus, shortness of breath, chest distress and the like of rheumatic heart disease.

The present invention is provides methods and formulations for preventing or ameliorating progression to chronic heart failure subsequent to cardiac stress, including as a consequence of myocardial infarction (MI), coronary artery disease, hypertension, cardiomyopathy, myocarditis, valvular regurgitation, severe lung disease, and / or severe anemia of chronic disease, by administration of one or more rate-limiting precursors to the synthesis of ATP. In one embodiment the ATP precursor is a pentose selected from one or more of ribose, D-ribose, ribulose, xylitol, xylulose, and a 5-carbon precursor of ribose.

The invention provides among other things methods and kits based on assaying for cardiac troponin autoantibodies, either in conjunction with an assay for cardiac troponin and / or as an independent indicator of cardiac pathology, such as myocarditis, cardiomyopathy, and / or ischemic heart disease. Assay methods of the invention can be employed among other things to identify cardiac pathology, or risk thereof, in subjects who have an autoimmune disease or who are related to an individual with an autoimmune disease. In particular embodiments, the invention also provides a method of determining whether a subject having, or at risk for, a cardiac pathology is a candidate for immunosuppressive therapy or immunoabsorption therapy. The invention also provides kits and kit components that are useful for performing the methods of the invention.

A method of prophylactic and / or therapeutic treatment of a mammal for a disease that is caused by a Ljungan virus infection, such as Myocarditis, Cardiomyopathia, Guillain Barré Syndrome, and Diabetes Mellitus, Multiple Sclerosis, Chronic Fatigue Syndrome, Myasthenia Gravis, Amyothrophic Lateral Sclerosis, Dermatomyositis, Polymyositis, Spontaneous Abortion, Intrauterine Death, Preeclampsia, Sudden Infant Death Syndrome, Bell's (facial) paralysis, Addison's disease, and Pernicious anemia, is described. An antiviral compound effective against a Ljungan virus, such as a compound effective against a picornavirus, e.g. Pleconaril or a derivative thereof, is used for the preparation of a medicament for the treatment of a disease in a mammal that is caused by a Ljungan virus infection, to eliminate or inhibit proliferation of the virus in the mammal and at the same time prevent and / or treat the disease in the mammal. A composition for treatment of a mammal for a disease caused by Ljungan virus infection including an antiviral compound, antiserum, and an interferon. A method of treatment of a mammal for a disease caused by a Ljungan virus infection.

The present invention relates to methods of identifying whether a candidate compound is a modulator of a G protein-coupled receptor (GPCR). In some embodiments, the GPCR is mammalian, preferably human. In some embodiments, the GPCR is expressed endogenously by cardiomyocytes. In some embodiments, the GPCR is coupled to Gq. In some embodiments, the GPCR increases the intracellular level of inositol 1,4,5-triphosphate (IP3). In some embodiments, a modulator of the GPCR is a modulator of cardiomyocyte hypertrophy. The present invention further relates to methods of using a modulator of the GPCR. Preferred modulators are inverse agonists and antagonists. Inverse agonists and antagonists of the invention are useful as therapeutic agents for the prevention or treatment of heart disease, including hypertrophic cardiomyopathy and congestive heart failure, in particular hypertrophic cardiomyopathy resulting from post-myocardial infarction remodeling, cardiac valve disease, sustained cardiac afterload, myocarditis, and familial hypertrophic cardiomyopathy.

The invention relates to a health care food, and in particular relates to a fruit and vegetable heart nourishing tea and a preparation method of the tea. The fruit and vegetable heart nourishing tea comprises pueraria flavone, seabuckthorn flavone, ginkgo flavone, soy isoflavone, coenzyme Q10, red ginseng, salviae miltiorrhizae, rhizoma alismatis, radix astragali, malt, blueberries, barbary wolfberry fruit and the like, and is prepared by grinding the cytoplasm of the raw materials in an ultrasonic way to obtain irregular granules. The fruit and vegetable heart nourishing tea can be used for the adjuvant therapy of various heart diseases in a way of dietary therapy, aims at the people with coronary heart disease, pulmonary heart disease, rheumatic heart disease, myocarditis, hypertension, hyperglycemia, hyperlipidemia, diabetes mellitus and the like, is strong in activity and high in cure rate, and enables the diseases not to easily relapse after the diseases are cured.