Patents
Literature
PatSnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

36 results about "Cardiac myosin" patented technology

Cardiac myosin is the major antigen in the myocardium. Using affinity-purified anti-myosin antibodies, Cunningham et al. 64 identified an epitope of the N-terminal M5 and M6 proteins consisting of a five-amino acid residue (Gln-Lys-Ser-Lys-Gln) that cross-reacted with cardiac myosin.

Compounds, compositions and methods

Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, and are useful in the treatment of systolic heart failure including congestive heart failure.
Owner:CYTOKINETICS INC

Compounds, compositions, and methods

Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, are useful in the treatment of systolic heart failure including congestive heart failure.
Owner:CYTOKINETICS INC

Preparation and composition of peptides useful for treatment of autoimmune and transplant related graft versus host conditions

InactiveUS6995237B1Effectively eliminate subsetDecrease and eliminate adverse effectPeptide/protein ingredientsAntibody mimetics/scaffoldsCardiac myosinDisease
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Owner:CEL SCI CORP

Use of traditional Chinese medicine in preparing medicine for treating myocardial infarction

ActiveCN101306158AImprove systolic functionReduce pro-inflammatory factorsPowder deliverySolution deliveryVentricular dilatationChinese traditional
The invention discloses the application of a Chinese traditional medicinal combination in preparing the medicaments used for curing myocardial infarction. The Chinese traditional medicinal combination inhibits the activity of matrix metalloproteinase, the damage to the heart support structure, the progressive ventricular dilatation, and the change of gene phenotype of the heavy chain of myosin of the cardiac muscle during the reversion of the restructuring of the cardiac muscle, thus inhibiting the restructuring of the cardiac muscle after myocardial infarction, improving the function of heart after myocardial infarction so that sufferers of myocardial infarction benefit from the Chinese traditional medicinal combination clinically, or the prognoses of myocardial infarction is improved.
Owner:HEBEI YILING MEDICINE INST

Methods for detecting mutations associated with hypertrophic cardiomyopathy

The invention pertains to methods for detecting the presence or absence of a mutation associated with hypertrophic cardiomyopathy (HC). The methods include providing DNA which encodes a cardiac myosin binding protein and detecting the presence or absence of a mutation in the amplified product which is associated with HC. The invention further pertains to methods for diagnosing HC in a subject. These methods typically include obtaining a sample of DNA which encodes a cardiac myosin binding protein from a subject being tested for FHC and diagnosing the subject for FHC by detecting the presence or absence of a mutation in the sarcomeric thin filament protein which causes FHC as an indication of the disease. Other aspects of the invention include kits useful for diagnosing HC and methods for treating HC.
Owner:PRESIDENT & FELLOWS OF HARVARD COLLEGE +1

Compounds, compositions and methods

Certain substituted sulfonamide derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, and are useful in the treatment of systolic heart failure including congestive heart failure.
Owner:CYTOKINETICS INC

Detecting mutations in the feline cardiac myosin binding protein C gene associated with hypertrophic cardiomyopathy in cats

The invention pertains to methods for detecting the presence or absence of a mutation associated with hypertrophic cardiomyopathy in cats, particularly domesticated cats, and more particularly Maine Coon cats. The methods include detecting the presence or absence of a mutation in the feline MYBPC gene, and identifying feline subjects that have or are at risk of developing hypertrophic cardiomyopathy.
Owner:UNIV OF CALIFORNIA DAVIS

Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions

InactiveUS7256254B2Effectively eliminate set and subsetTreating or preventing inappropriate autoimmune responsePeptide/protein ingredientsPeptide sourcesCardiac myosinImmunologic disorders
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Owner:CEL SCI CORP

Substituted urea derivatives for treating cardiac diseases

Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, and are useful in the treatment of systolic heart failure including congestive heart failure.
Owner:CYTOKINETICS INC

Cmybp-c and MLC2 as diagnostic markers of cardiac injury

The invention relates to markers for acute myocardial infarction (AMI), particularly markers that may be used in the rapid and accurate diagnosis of AMI or reinfarction. A method of diagnosing cardiac injury comprising identifying an elevated concentration of cardiac myosin binding protein C (cMyBP-C) or a fragment thereof or myosin regulatory light chain 2 (MLC2) or a fragment thereof in a sample obtained from a subject.
Owner:KINGS COLLEGE LONDON

Immunomagnetic bead-based time-resolved fluorescence immunoassay kit of cardiac myosin binding protein C (cMyBP-C)

The invention provides an immunomagnetic bead-based time-resolved fluorescence immunoassay kit of cardiac myosin binding protein C (cMyBP-C). The kit includes a calibrator, immunomagnetic beads, immunofluorescence microspheres, analysis buffering liquid and wash liquid. The magnetic beads are coupled with antibodies, and the time-resolved fluorescence microspheres are coupled with the antibodies;thus the two parts form immunomagnetic beads-cMyBP-C antigen-immunofluorescence microsphere complexes with cMyBP-C antigens in a sample in a reaction tube after shaking incubation; a time-resolved instrument is used to determine intensity of fluorescence emitted thereby under excitation of ultraviolet light; and comparison of a standard curve is carried out to determine the amount of the cMyBP-C antigens in the sample. The kit of the invention greatly shortens reaction time, and improves efficiency and sensitivity of detection.
Owner:江苏美克医学技术有限公司

Cardio myopeptidin, the production and the use thereof

The present invention relates to a cardio myopeptidin which is isolated from the hearts of non-human healthy mammals. The molecular weight of the cardio myopeptidin is less than 10000 Dalton, the peptide content thereof being 75%˜90%, the free amino acid content 6%˜15%, the ribonucleic acid content less than 2%, and the deoxyribonucleic acid content less than 7.5%. The present invention further provides a method of producing the cardio myopeptidin and the use thereof in producing pharmaceuticals for treating cardiac disorders, specifically the use in producing pharmaceuticals for treating myocardial ischemic and reperfusion injury. The cardio myopeptidin of the present invention can work directly on myocytes, promoting the repair of injuries caused by various reasons, and providing a new way to relieve ischemic and reperfusion injury, and to promote the repair of injured myocardium.
Owner:DALIAN ZHEN AO PHARMA

Compounds, compositions and methods

Certain substituted urea derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, and are useful in the treatment of systolic heart failure including congestive heart failure.
Owner:CYTOKINETICS INC

Compositions and methods for treating heart failure

Certain substituted benzamide derivatives selectively modulate the cardiac sarcomere, for example by potentiating cardiac myosin, and are useful in the treatment of systolic heart failure including congestive heart failure.
Owner:CYTOKINETICS INC

Cardio myopeptidin, the production and the use thereof

The present invention relates to a cardio myopeptidin which is isolated from the hearts of non-human healthy mammals. The molecular weight of the cardio myopeptidin is less than 10000 Dalton, the peptide content thereof being 75%˜90%, the free amino acid content 6%˜15%, the ribonucleic acid content less than 2%, and the deoxyribonucleic acid content less than 7.5%. The present invention further provides a method of producing the cardio myopeptidin and the use thereof in producing pharmaceuticals for treating cardiac disorders, specifically the use in producing pharmaceuticals for treating myocardial ischemic and reperfusion injury. The cardio myopeptidin of the present invention can work directly on myocytes, promoting the repair of injuries caused by various reasons, and providing a new way to relieve ischemic and reperfusion injury, and to promote the repair of injured myocardium.
Owner:DALIAN ZHEN AO PHARMA

Hybridoma cell lines (my-c-cc0c2-235-3h8) and use thereof for producing a monoclonal antibody against the human cardiac myosin binding protein c (c-protein, mybpc3, cmybp-c or my-c)

ActiveUS20170088629A1Early diagnosis of cardiac infarctionsImmunoglobulins against animals/humansDisease diagnosisCardiac myosinBlood plasma
Monoclonal antibodies, which can be produced in vitro, against cardiac epitopes of the human My-C are produced by generating myeloma cell clones that produce such specific antibodies having epitope specificity. These monoclonal antibodies allow, among other things, the creation of an enzyme-linked immunosorbent assay (ELISA) for the specific, cross-reactivity-free quantitative determination of My-C in serum, plasma, whole blood or other body fluid. Specifically, a hybridoma cell clone producing a monoclonal antibody that detects and binds a cardiac epitope in the My-C is produced, which has no cross-reactivity with respect to the myosin-binding proteins of the skeletal muscles. The hybridoma cell line can be obtained by fusing myeloma cells with spleen cells of a test animal, in particular a mouse, immunized against recombinant My-C. The invention furthermore relates to epitope-specific antibodies produced by the hybridoma cell line, and to the use thereof.
Owner:KINGS COLLEGE LONDON

Preparation method of anti-myocardial antibody quadruple diagnostic kit

The invention discloses a preparation method of an anti-myocardial antibody quadruple diagnostic kit. The anti-myocardial antibody quadruple diagnostic kit provided by the invention is formed by respectively coating four segments of anti-myocardial antibody peptides, namely an anti-myocardial mitochondrial adenosine transferase antibody, a beta1 adrenoceptor antibody, an anti-calcium channel antibody and a cardiac myosin heavy chain antibody. The kit provided by the invention is used to detect an anti-cardiomyopeptidin antibody in serum of a suspected DCM patient. By the kit, diagnosis level of DCM can be improved, and early diagnosis is realized.
Owner:WUHAN HUAJIYUAN BIOTECH DEV

Nanometer gold cage compound, and applications thereof in preparation of kit used for detecting cMyBP-C in human urine or blood

The invention discloses a nanometer gold cage compound, and applications thereof in preparation of a kit used for detecting cMyBP-C in human urine or blood. The nanometer gold cage compound is capableof realizing covalent boding with a pair of anti-human cardiac myosin C monoclonal antibody BT09 and BT10, and forming the kit used for rapid detection of cMyBP-C in human urine or blood. The nanometer gold cage compound is used for replacing conventional spherical nanometer particles commonly used in colloidal gold test strips, is extremely high in human blood and / or urea cMyBP-C detection sensitivity and specificity; distinguishing light signals better that those of the spherical nanometer particles are generated based on the white background. At specific application conditions (size and diameter), the cube hollow nanometer crystal is capable of realizing covalent bond combination with DNA and proteins, biotin labelled single chain DNA is capable of connecting nanometer antibodies of two sizes, the detection signal is increased by 5000 to 10000 times of that of colloidal gold nanometer sphere POCT product. It is observed in results that the sensitivity is as high as 100fg / mL, reading of results is realized in 15min, and excellent stability and repeatability are achieved.
Owner:南京博天科智生物技术有限公司

Quantitative determination method of cardiac myosin binding protein C and detection kit

The invention discloses a quantitative determination method of cardiac myosin binding protein C. According to the method, firstly, antibody coupling super paramagnetic micro particles and samples to be tested take specific combination reaction to obtain a first reactant, wherein the antibody coupling super paramagnetic micro particles are products obtained by coupling super paramagnetic micro particles and anti-cMyBP-C monoclonal antibodies A; then, the first reactant is taken to perform specific combination reaction with enzyme-labeled articles to obtain a second reactant, wherein the enzyme-labeled articles are products obtained by coupling enzymes and anti-cMyBP-C monoclonal antibodies B; finally, chemiluminescence substrates and the second reactant are taken to take enzymatic reaction;luminous signals are determined; the concentration value of cMyBP-C is obtained. The technology mode of the invention is a sandwich method. Compared with a cMyBP-C ELISA kit, the detection method andthe prepared kit have the advantages that the detection sensitivity and the linear range can be greatly improved. The technology evaluation on the prepared kit shows that the analysis sensitivity is0.05 ng / ml; the detection range is 0.1 to 50 ng / ml; high correlation and coincidence rate to clinic AMI patients are high.
Owner:AUTOBIO DIAGNOSTICS CO LTD

Methods and assays for risk prediction, diagnosis, and analysis of myocardial infarction, heart failure and reduced cardiac function

Methods and kits adapted for risk prediction, diagnosis, and analysis of myocardial infarction (MI), myocardial failure, and reduced cardiac function such as heart failure. The methods include collecting a sample of human body fluid or tissue from a subject and then identifying the presence of cardiac myosin binding protein-C 25-nucleotide deletion and / or detecting the presence of cardiac myosin binding protein-C, its peptides, its phosphorylation status, and / or its autoantibodies in the human body fluid or tissue.
Owner:LOYOLA UNIV OF CHICAGO

Nonmuscle myosin ii inhibitors for substance use relapse

The invention can provide compounds, analogs of blebbistatin, effective and selective inhibitors of nonmuscle myosin II relative to cardiac myosin II. Compounds can be used in the method of treating adisease, disorder, or medical condition in a patient, comprising modulating myosin II ATPase, such as treatment of substance abuse relapse disorder, or of renal disease, cancer and metastasis, benignprostate hyperplasia, hemostasis or thrombosis, nerve injury including retinal damage, lung fibrosis, liver fibrosis, arthrofibrosis, wound healing, spinal cord injury, periodontitis, glaucoma and immune-related diseases including multiple sclerosis; or wherein the disease, disorder, or medical condition comprises addiction including abuse of or addiction to anything classified as a Substance-Related or Addictive Disorder in the Diagnostic and Statistical Manual of Mental Disorders (DSM), such as, but not limited to, cocaine, opioids, amphetamines, ethanol, cannabis / marijuana, nicotine, and activities including gambling Compounds are of general formula (I) with substituents as defined herein.
Owner:UNIV OF FLORIDA RES FOUNDATION INC

Methods and compositions for rapidly replacing cardiac myosin binding protein-C in sarcomeres

Methods and compositions for rapidly replacing cMyBP-C in sarcomeres featuring the creation of Spy-C mice, which are mice genetically engineered to express cMyBP-C with a protease recognition site and SpyTag peptide introduced into the cMyBP-C gene. In permeabilized myocytes from the Spy-C mice, the cMyBP-C protein can be cleaved at the protease recognition site, and the N-Terminus of cMyBP-C can be removed while the C-terminus remains anchored to the thick filament. A new peptide featuring the SpyCatcher sequence can be covalently bonded to the remaining portion of cMyBP-C, thereby creating a modified cMyBP-C protein. The methods and compositions of the present invention allow for the reconstitution of full-length cMyBP-C at the precise position of native cMyBP-C in the sarcomere and allow for a variety of modifications to be introduced to cMyBP-C in situ.
Owner:THE ARIZONA BOARD OF REGENTS ON BEHALF OF THE UNIV OF ARIZONA

Hybridoma cell lines (my-c-cc0c2-259-1 a4) and use thereof for producing a monoclonal antibody against human cardiac myosin binding protein c (c-protein, mybpc3, cmybp-c or my-c)

The aim of the invention is to produce, in vitro, monoclonal antibodies against cardiac epitopes of the human My-C by generating myeloma cell clones, which produce said specific antibodies with epitope specificity. Said monoclonal antibodies should, amongst other things, enable an ELISA (Enzyme-Linked Immuno Sorbent Assay) for the specific, cross-reactivity free quantitative determination of My-C in serum, plasma or full blood, to be formed. Said aim is achieved by generating a hybridome cell clone which produces a monoclonal antibody which recognizes and binds with a cardiac epitope in the My-C and which does not have the cross-reactivity with respect to the myosin binding proteins of the skeletal muscle. Said hybridome cell line can be obtained by fusing myelome cells with spleen cells of a test animal, in particular a mouse, immunized against recombined My-C. The invention also relates to epitope specific antibodies produced by the hybridome cell lines and to the use thereof.
Owner:KINGS COLLEGE LONDON

Methods and compositions for rapidly replacing cardiac myosin binding protein-c in sarcomeres

Methods and compositions for rapidly replacing cMyBP-C in sarcomeres featuring the creation of Spy-C mice, which are mice genetically engineered to express cMyBP-C with a protease recognition site and SpyTag peptide introduced into the cMyBP-C gene. In permeabilized myocytes from the Spy-C mice, the cMyBP-C protein can be cleaved at the protease recognition site, and the N-Terminus of cMyBP-C can be removed while the C-terminus remains anchored to the thick filament. A new peptide featuring the SpyCatcher sequence can be covalently bonded to the remaining portion of cMyBP-C, thereby creating a modified cMyBP-C protein. The methods and compositions of the present invention allow for the reconstitution of full-length cMyBP-C at the precise position of native cMyBP-C in the sarcomere and allow for a variety of modifications to be introduced to cMyBP-C in situ.
Owner:THE ARIZONA BOARD OF REGENTS ON BEHALF OF THE UNIV OF ARIZONA

CMYBP-C and MLC2 as diagnostic markers of cardiac injury

The invention relates to markers for acute myocardial infarction (AMI), particularly markers that may be used in the rapid and accurate diagnosis of AMI or reinfarction. A method of diagnosing cardiac injury comprising identifying an elevated concentration of cardiac myosin binding protein C (cMyBP-C) or a fragment thereof or myosin regulatory light chain 2 (MLC2) or a fragment thereof in a sample obtained from a subject.
Owner:KINGS COLLEGE LONDON

Myosin Derived Peptides and Related Compounds with Anticoagulant Activities

The present invention provides myosin derived peptides, variants and derivative compounds that are anti-coagulant. Also provided in the invention are antibodies that specifically target the peptides or epitopes presented thereon. Further provided in the invention are methods directed to using the anti-coagulant compounds described herein in therapeutic applications, e.g., inhibiting myosin-supported prothrombin activation to reduce the risk of acute trauma coagulopathy in post-trauma patients or inhibiting cardiac myosin-supported prothrombin activation to reduce the risk of coronary thrombosis.
Owner:THE SCRIPPS RES INST +1

Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions

InactiveUS20060088544A1Effectively eliminate subsetDecrease and eliminate adverse effectPeptide/protein ingredientsDepsipeptidesCardiac myosinDisease
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Owner:CEL SCI CORP