Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

41 results about "Th2 response" patented technology

Medical Definition of Th2 response. 1. An acquired immune response whose most prominent feature is high antibody production relative to the amount of cytotoxic T lymphocyte activity The Th2 response is promoted by CD4+ Th2 T helper cells. See: TO Response.

Therapy-enhancing glucan

The present invention relates to methods of using neutral soluble glucan and monoclonal antibodies for antitumor therapy. Neutral soluble Beta (1,3; 1,6) glucan (NSG) enhances the tumoricidal activity of the innate immune system by binding to the C3 complement protein receptor CR3. The glucan does not stimulate the induction of inflammatory cytokines. Also described are methods of using whole glucan particles (WGP) as an immunomodulator by inducing a shift from a Th2 response to the Th1 response, leading to an enhanced antitumor cytotoxic T-cell response.
Owner:UNIV OF LOUISVILLE RES FOUND INC +1

Preparation and composition of peptides useful for treatment of autoimmune and transplant related graft versus host conditions

InactiveUS6995237B1Effectively eliminate subsetDecrease and eliminate adverse effectPeptide/protein ingredientsAntibody mimetics/scaffoldsCardiac myosinDisease
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Owner:CEL SCI CORP

Vaccine and immunotherapy for solid nonlymphoid tumor and related immune dysregulation

Provided are vaccines, methods of making the vaccines and methods for administering the vaccines for immunotherapy of an individual bearing, or at risk for developing, solid nonlymphoid tumor. The vaccine comprises an immunotherapeutic composition and tumor-associated antigen, and may further comprise one or more of an immunomodulator or a pharmaceutically acceptable carrier. A method of immunotherapy of an individual comprises administering to the individual an amount of the vaccine effective to suppress a TH2 response, and to induce a TH1 response against solid nonlymphoid tumor, in an individual having a TH2 / TH1 imbalance.
Owner:BIOCRYSTAL LTD

Immunomodulatory dairy peptides and uses thereof

The present invention provide a new method for modulating the immune system of a subject in need thereof by administering a dairy-derived peptide to the subject, particularly a β-lactoglubulin-derived peptide (β-Lg peptide). According to one aspect, the modulation of the immune system is the modulation of a Th1 response. According to another aspect, the modulation of the immune system is the modulation of a Th2 response.
Owner:UNIV LAVAL

Chimeric molecule for the treatment of th2-like cytokine mediated disorders

The invention provides uses and methods for alleviating respiratory tract symptoms of allergy, asthma, and of viral, bacterial, fungal and parasitic infections by shifting inappropriate TH2 responses to TH1 responses by administering IL-13 receptor-targeted immunotoxins to the respiratory tract.
Owner:US DEPT OF HEALTH & HUMAN SERVICES +1

Methods and uses of leptin in immune modulation

The present invention describes the use of leptin for the immune modulation of the Th1 / Th2 response. One aspect of the invention provides for a shift in the Th1 / Th2 cell balance towards pro-inflammatory cytokine producing cells. This shift results from an increase in the levels, expression and / or the activity of leptin. Another aspect of the invention provides for a shift in the Th1 / Th2 cell balance towards anti-inflammatory cytokine producing cells. This shift results from a decrease in the levels, expression and / or the activity of leptin. The shifting of the Th1 / Th2 balance provides a method for the treatment of a variety of diseases and disorders.
Owner:ENZO THERAPEUTICS

Methods and uses of leptin in immune modulation and hepatocellular carcinoma

The present invention relates to methods for the modulation of immune responses. More particularly, the invention relates to methods and uses of leptin for immune-modulation of the balance between the Th1 / Th2 responses and for the treatment of immune-related disorders. Specifically, the methods of the invention comprise shifting the Th1 / Th2 cell balance towards the proinflammatory state. This modulation of the cell balance may be performed by increasing the activity and / or the expression of leptin in a subject, for instance by raising the amount of leptin. The amount of leptin in a subject may be increased by activating immunoregulatory cells, or by administering an immunomodulatory amount of leptin or a homologue, derivative, or functional fragment of leptin.
Owner:ENZO THERAPEUTICS

Compound astragalus polysaccharides and echinacea purpurea herb nanoemulsion adjuvant and preparation method thereof

The invention discloses a compound astragalus polysaccharides and echinacea purpurea herb nanoemulsion adjuvant, the partical size of which is between 1nm and 100nm, and is composed by echinacea purpurea herb, astragalus polysaccharides, surface active agent, cosurfactant, oil and distilled water. The product presents clear light yellow liquid, has the partical size smaller than 100nm, has lower viscosity and better stability, does not need special emulation when seedling, and has low requirements on equipment and easy controlled product quality. By taking albumin egg OVA as model antigen, tests show that the compound astragalus polysaccharides and echinacea purpurea herb nanoemulsion adjuvant of the invention has better immunoreaction than using aluminium adjuvant in a certain dosage, has higher antibody titer, reduces the dosage of oil or antigen in the adjuvant, stimulates the reaction of Th1 and Th2, increases the immunization of the liquid and the cell of the an organism, and plays a good role of immune protection of the organism.
Owner:NORTHWEST A & F UNIV

Compound panax ginseng total saponin and levamisole nano emulsion adjuvant and preparation method thereof

The invention discloses a compound panax ginseng saponin and levamisole nano emulsion adjuvant. The adjuvant has the particle diameter of 1-100 nm and comprises panax ginseng saponin, levamisole, a surface active agent, a cosurfactant, oil and distilled water. The product is transparent faint yellow liquid in appearance, and the particle parameter is smaller than 100 nm; the viscosity is lower, and the viscosity requirement of emulsion as a vaccine adjuvant is met; the stability is higher, and the product can be preserved at room temperature or 4 DEG C for a long time; the special emulsification is not needed during seedling preparation, the requirement to equipment is low, and the quality of the product is easy to control. Egg white albumin (OVA) as mode antigen indicates that the compound panax ginseng saponin and levamisole nano emulsion adjuvant can induce better immune reaction than an aluminum adjuvant in a certain dosage, generate higher antibody titer, reduce the dosage of theadjuvant or the antigen, simulate Th1 and Th2 reaction, reinforce the body fluid and cell immunization of an organism and play a role of complete immune protection.
Owner:NORTHWEST A & F UNIV

Vaccine and immunotherapy for solid nonlymphoid tumor and related immune dysregulation

Provided are vaccines, methods of making the vaccines and methods for administering the vaccines for immunotherapy of an individual bearing, or at risk for developing, solid nonlymphoid tumor. The vaccine comprises an immunotherapeutic composition and tumor-associated antigen, and may further comprise one or more of an immunomodulator or a pharmaceutically acceptable carrier. A method of immunotherapy of an individual comprises administering to the individual an amount of the vaccine effective to suppress a TH2 response, and to induce a TH1 response against solid nonlymphoid tumor, in an individual having a TH2 / TH1 imbalance.
Owner:BIOCRYSTAL LTD

Methods and uses of leptin in hepatocellular carcinoma

The present invention relates to methods for the modulation of immune responses. More particularly, the invention relates to methods and uses of leptin for immuno-modulation of the balance between the Th1 / Th2 responses and for the treatment of immune-related disorders. Specifically, the methods of the invention comprise shifting the Th1 / Th2 cell balance towards the proinflammatory state. This modulation of the cell balance may be performed by increasing the activity and / or the expression of leptin in said subject, for instance by raising the amount of leptin. The amount of leptin in a subject may be increased by activating immunoregulatory cells, administering an immunomodulatory amount of leptin or a homologue, derivative, or functional fragment of leptin.
Owner:ENZO THERAPEUTICS

Immunomodulatory compositions

Isolated immunomodulatory (e.g. immunostimulatory) polyhydroxlated pyrrolizidine compounds having the formula are disclosed. In these compounds R is selected from hydrogen, straight or branched, unsubstituted or substituted, saturated or unsaturated acyl, alkyl (e.g. cycloalkyl), alkenyl, alkynyl and aryl groups. The compounds are useful in therapy and prophylaxis, including increasing the Th1:Th2 response ratio, hemorestoration, alleviation of immunosuppression, cytokine stimulation, treatment of proliferative disorders (e.g. cancer), vaccination, stimulation of the innate immune response and boosting of the activity of endogenous NK cells.
Owner:SUMMIT WALES +1

Methods of preparation and composition of peptide constructs useful for treatment of autoimmune and transplant related host versus graft conditions

InactiveUS7256254B2Effectively eliminate set and subsetTreating or preventing inappropriate autoimmune responsePeptide/protein ingredientsPeptide sourcesCardiac myosinImmunologic disorders
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
Owner:CEL SCI CORP

Chimeric molecule for the treatment of th2-like cytokine mediated disorders

The invention provides uses and methods for alleviating respiratory tract symptoms of allergy, asthma, and of viral, bacterial, fungal and parasitic infections by shifting inappropriate TH2 responses to TH1 responses by administering IL-13 receptor-targeted immunotoxins to the respiratory tract.
Owner:UNITED STATES OF AMERICA +1

Novel lactic acid bacterium strains and application thereof to adjustment of immune reaction

The invention relates to novel lactic acid bacterium strains MP137 and MP108 and the application thereof to the adjustment of immune reaction. Specifically, the lactic acid bacterium strains can promote Th1 reaction and inhibit Th2 reaction.
Owner:CHING BIOTECH CO LTD +1

Methods and uses of leptin in immune modulation

The present invention describes the use of leptin for the immune modulation of the Th1 / Th2 response. One aspect of the invention provides for a shift in the Th1 / Th2 cell balance towards pro-inflammatory cytokine producing cells. This shift results from an increase in the levels, expression and / or the activity of leptin. Another aspect of the invention provides for a shift in the Th1 / Th2 cell balance towards anti-inflammatory cytokine producing cells. This shift results from a decrease in the levels, expression and / or the activity of leptin. The shifting of the Th1 / Th2 balance provides a method for the treatment of a variety of diseases and disorders.
Owner:ENZO THERAPEUTICS

Immunomodulating probiotic lactic acid bacteria

The present invention relates to immuno modulating probiotic lactic acid bacteria, to methods wherein the bacteria are used to reduce allergy, and to food products wherein the bacteria may be in incorporated to reduce allergy upon consumption of the product. Preferred probiotic lactic acid bacteria stimulate the Th1 and / or Th3 responses and / or represses Th2 responses as may be determined by the cytokine profiles that are induced in human peripheral blood mononuclear cells upon coincubation with the lactic acid bacteria.
Owner:FRIESLANDCAMPINA NEDERLAND BV

Method of treating respiratory virus-induced asthma with Th2 lymphocyte NKG2A receptor agonists

ActiveUS20080118516A1Protection protectionEnhanced signalMicroorganismsAntiviralsTh2 responseLymphocyte
We previously reported that NKG2A, a key inhibitory ligand for HLA-E, is expressed on activated TH2, but not TH1, cells. Here we measured cytokine expression in ex vivo TH2 cells and in a mouse model of asthma upon activation with antiCD3 / 28 and challenge with an NKG2A-specific agonist We show that signaling through NKG2A modulates Th2 cell effector function. This new molecular pathway data provides a novel explanation and treatment for respiratory virus-associated asthma. RSV and hMPV suppress IFN-γ and HLA-E expression and therefore decrease NKG2A signaling in activated TH2 cells. This results in a relatively robust Th2 response and an unfavorable shift in Th1 / Th2 balance. The data presented here suggest that increasing signaling via the NKG2A receptor suppresses Th2 effector function and could positively impact Th1 / Th2 balance in asthma.
Owner:CHILDRENS NAT MEDICAL CENT

A strain of Lactobacillus reuteri that can alleviate the th2 response of allergic asthma and its application

The invention discloses a strain of Lactobacillus reuteri capable of alleviating the Th2 response of allergic asthma and an application thereof, belonging to the technical field of microbes and the technical field of medicine. The Lactobacillus reuteri of the present invention has the effect of alleviating allergic asthma, which is specifically reflected in: (1) significantly reducing the lung inflammatory response of allergic asthma mice; (2) significantly inhibiting allergic asthma Production of total immunoglobulin IgE in mouse serum; (3) significantly reduce the content of IL-5 in the lungs of mice with allergic asthma; (4) significantly reduce the content of IL-13 in the lungs of mice with allergic asthma; (5) Significantly increase the content of propionic acid in the intestinal tract of mice with allergic asthma, therefore, Lactobacillus reuteri (Lactobacillus reuteri) has great application prospects in the preparation of products for the prevention and / or treatment of allergic asthma .
Owner:JIANGNAN UNIV

Compositions and methods for treating thymic stromal lymphopoietin (tslp)-mediated conditions

InactiveCN102257130AOrganic active ingredientsSenses disorderAllergic airway inflammationTh2 response
Provided are methods for treating a TSLP-mediated or TSLPR-mediated disease or condition, comprising administration of an electrokinetically altered aqueous fluid comprising an ionic aqueous solution of charge-stabilized oxygen-containing nanostructures substantially having an average diameter of less than about 100 nanometers and stably configured in the ionic aqueous fluid in an amount sufficient for treating a TSLP-mediated or TSLPR-mediated disease or condition. The charge-stabilized oxygen-containing nanostructures are preferably stably configured in the fluid in an amount sufficient to provide for modulation of cellular membrane potential and / or conductivity. Certain aspects comprising modulation or down-regulation of TSLP expression and / or activity have utility for treating TSLP-mediated or TSLPR-mediated diseases or conditions as disclosed herein (e.g., disorders of the immune system, allergic inflammation, allergic airway inflammation, DC-mediated inflammatory Th2 responses, atopic dermatitis, atopic eczema, asthma, obstructive airways disease, chronic obstructive pulmonary disease, and food allergies, inflammatory arthritis, rheumatoid arthritis, psoriasis, IgE-mediated disorders, and rhino-conjunctivitis).
Owner:REVALESIO CORP

Cancer therapy using beta glucan and antibodies

The present invention relates to methods of using neutral soluble glucan and monoclonal antibodies for antitumor therapy. Neutral soluble Beta (1,3; 1,6) glucan (NSG) enhances the tumoricidal activity of the innate immune system by binding to the C3 complement protein receptor CR3. The glucan does not stimulate the induction of inflammatory cytokines. Also described are methods of using whole glucan particles (WGP) as an immunomodulator by inducing a shift from a Th2 response to the Th1 response, leading to an enhanced antitumor cytotoxic T-cell response.
Owner:UNIV OF LOUISVILLE RES FOUND INC +1

Composition for enhancing induction of humoral immunity, and vaccine pharmaceutical composition

The present invention aims to provide a composition for promoting humoral immunity induction and a vaccine pharmaceutical composition that can be universally used for various antigens in inducing humoral immunity to antigens, contain a Th2 reaction promoter, and exerts a high humoral immunity inducing effect. The present invention relates to a vaccine pharmaceutical composition containing an antigen for humoral immunity induction and at least one Th2 reaction promoter.
Owner:NITTO DENKO CORP

Material and methods for diagnosing and treating kawasaki disease and kls

Two patients diagnosed with KLS were treated. One patient had severe KLS that progressed to the equivalent of pediatric Kawasaki Disease Shock E Syndrome (KDSS). The second patient had a typical KLS presentation and clinical course. Cytokines and chemokines provide inflammatory signatures in the serum that reflect the polarity of the immune response and the affected cell types. Multiplex ELISA technology was used to define the cytokine milieu in the serum of the two adult IIIV patients with KLS during the acute and convalescent phases. Those sera were compared with sera from asymptomatic HIV subjects and a normal serum control. Those comparisons suggest that HIV KLS is a dysfunctional Th2 response to an unknown inciting agent in the vascular wall, and that a multiplex ELISA or similar technology based a limited combination of KLS / KD pathogenesis-related cytokines (IL-6, IL-13, sTNFRII) and endothelial / smooth muscle chemokines (CCL1, CCL2, CxCL11 may provide an objective tool for diagnosing KLS and Kawasaki Disease. Because KD and HIV KLS are the only known “Th2” vasculitidies that spare the lungs (unique clinical presentation) and include plasma cell infiltration of the vascular wall as a prominent histopathologic feature (unique pathophysiology), a diagnostic test based on combinations of the above analytes will be highly specific and therefore clinically useful.
Owner:JOHNSON RAYMOND M

Reprogramming immune environment in breast cancer via dendritic cells

Compositions and methods for the treatment of cancer disclosed herein. The method of the present invention comprises administration of compositions comprising β-glucan, a natural ligand for dectin-1, to block OX40L expression on tumor associated mDCs by blocking STAT6 phosphorylation. The β-glucan-treated mDCs secrete higher levels of IL-12p70 and do not expand TNFα and IL-13-producing CD4+ T cells, further resulting in inhibition of Th2 responses. Thus, compositions disclosed herein reprogram the function of mDCs in breast tumor microenvironment and turn tumor promoting Th2-type chronic inflammation into Th1-type acute inflammation that are able to reject tumors. The present invention finds particular uses for the intratumoral administration of the composition thereby directly binding to and directing a Th1-type acute inflammation.
Owner:BAYLOR RES INST

Vaccines comprising truncated HBC core protein plus saponin-based adjuvants

Composition (A) comprises (i) one or more hepatitis B core antigens (HBcAg) containing amino acids 1 to x (x = 100-160),their fragments, variants of fragment variants; (ii) an adjuvant containing a saponin and / or saponin derivative; and (iii) optionally, one or more hepatitis B surface antigens (HBsAg), or their fragments, variants or variant fragments. - ACTIVITY : Virucide; Hepatotropic; Antiinflammatory. Mice were immunized with a composition containing 5 mu g AbISCO-200 (RTM for a saponin composition) and 10 mu g HBcAg1-144+1 in 0.1 ml phosphate-buffered saline. The number of CD8+> cells that expressed gamma -interferon was just over 100 per 105> such cells; compared with zero when the same antigen was administered without saponin. When the composition also contained 5 mu g HBsAg, the number of such cells was 170 / 105>. The composition also resulted in high levels of immunoglobulins G1 and G2b, indicating a Th1 / Th2 response. - MECHANISM OF ACTION : Vaccine.
Owner:RAJN BIOTEKH GEZELLSHAFT FJUR NOJE BIOTEKHNOLOGISHE PROTSESSE & PROD MBKH