48 results about "Th1 response" patented technology

The invention provides methods of modulating an immune response to a second antigen which entail administration of a first antigen and an immunostimulatory polynucleotide. Modulation of the immune response is generally manifested as stimulation of a Th1 response.

Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

Provided are vaccines, methods of making the vaccines and methods for administering the vaccines for immunotherapy of an individual bearing, or at risk for developing, solid nonlymphoid tumor. The vaccine comprises an immunotherapeutic composition and tumor-associated antigen, and may further comprise one or more of an immunomodulator or a pharmaceutically acceptable carrier. A method of immunotherapy of an individual comprises administering to the individual an amount of the vaccine effective to suppress a TH2 response, and to induce a TH1 response against solid nonlymphoid tumor, in an individual having a TH2/TH1 imbalance.

Influenza vaccines containing insoluble particulate adjuvants have been found to elicit an IgG response that is primarily a TH2 response (IgG1). This response can be shifted towards a TH1 response (IgG2a) by including immunopotentiators in the compositions. Thus the invention provides an immunogenic composition comprising: (i) an influenza virus antigen; (ii) an insoluble particulate adjuvant; and (iii) a immunopotentiator.

The invention relates to a method of treating an excessive immune response including an aberrant/enhanced Th1 response by administering a helminthic parasite preparation in an amount sufficient to reduce the excessive immune response in an individual. This invention is generally directed to autoimmune diseases which involve an excessive immune response or an aberrant/enhanced Th1 response. More specifically, the present invention is directed to the treatment of Crohn's disease and ulcerative colitis, both known as IBD. While the present invention discloses specific information about the treatment of IBD, the disclosure is in no way limiting. Additionally, rheumatoid arthritis, type 1 diabetes mellitus, lupus erythematosis, sarcoidosis, multiple sclerosis, autoimmune thyroiditis, allergic rhinitis, colon polyps/colon cancer and asthma can be treated by the methods and compositions disclosed therein.

The invention provides uses and methods for alleviating respiratory tract symptoms of allergy, asthma, and of viral, bacterial, fungal and parasitic infections by shifting inappropriate TH2 responses to TH1 responses by administering IL-13 receptor-targeted immunotoxins to the respiratory tract.

Liposomes are known to enhance the activity of K- (B-) type CpGs which trigger the production of IL-12. In the present invention, the surprising finding was made that liposomes also enhance the activity of D- (A-) type CpGs, leading to the production of IFNα in vivo. These findings are relevant for the humans situation, since IFNα rather than IL-12 is the key cytokine for the induction of Th1 responses and anti-viral protection in humans.

Vaccination with the combination of Ag85B-TB10.4 and IC31® adjuvant generated a high amount of polyfunctional CD4⁺T cells expressing high levels of IFN-γ, TNF-α, and IL-2. This in turn led to significant protection against infection with M. tuberculosis in the mouse aerosol challenge model of tuberculosis. Both the immunogenicity of the vaccine and its ability to protect against TB infection was highly dependent on the antigen dose. Thus, whereas the standard antigen dose of 5 μg, as well as 15 μg, did not induce significant protection against M. tuberculosis, reducing the dose to 0.5 μg increased both the immunogenicity of the vaccine as well as its protective efficacy to a level comparable to that observed in BCG vaccinated mice. Thus, the IC31® adjuvant, with the specified antigen dose, can induce a strong protective Th1 response against M. tuberculosis.

A method of providing a reproducible and clinically relevant disease activity measurement for a group of immunologic disorders that share features of a T “helper” 1 (Th1) immune activation phenotype is disclosed. Th1 responses are characterized by the release of a set of pro-inflammatory substances by white blood cells (WBC) By evaluating the ex vivo activation response of whole blood in terms of the extent of release of Th1 produced pro-inflammatory substances in blood (i.e., WBC activity) following activation with a Th1-associated stimulant, the level of, e.g., disease activity or immunosuppression in a specific individual can be determined. The method of the invention provides a disease activity marker for a wide variety of Th1 inflammatory responses, including Crohn's Disease, psoriasis, rheumatoid arthritis, Systemic Lupus Erythematosus (SLE), multiple sclerosis and solid organ transplant rejection.

The invention relates to novel lactic acid bacterium strains MP137 and MP108 and the application thereof to the adjustment of immune reaction. Specifically, the lactic acid bacterium strains can promote Th1 reaction and inhibit Th2 reaction.

The invention provides a mucosal adjuvant. The mucosal adjuvant is prepared by copolymerization crosslinking compounding of oligo-chitosan and lymphotactin encoding plasmids. The invention also discloses a preparation method and a use of the mucosal adjuvant. When the mucosal adjuvant and a gene vaccine composed of chitosan or oligo-chitosan are synchronously dropped into a nasal cavity for immunization, coxsackievirus specific serum antibody and systemic (spleen and lymph glands) Th1-type immune responses are induced and especially, intestinal mucosa partially-reinforced specific-secretion-type sIgA and IFNgama+Th1 responses are induced, and thus a gene vaccine used with the mucosal adjuvant is obviously superior to an exposed gene vaccine and effectively prevents coxsackievirus-caused myocarditis. The mucosal adjuvant can be used as a novel mucosal vaccination adjuvant.

The invention discloses a streptococcus-suis-disease-resistant fusion protein with the autoimmune activity and preparing and application thereof. The fusion protein is composed of Omp16<26-168> peptide located at the amino terminal and Sao<28-138> peptide located at the carboxyl terminal. The Sao<28-138> peptide is an amino acid fragment which is exposed out of a streptococcus suis cell in a Sao protein molecule, has the immunogenicity, and is highly conservative between different strains and subtypes, and the Omp16<26-168> peptide is an amino acid fragment is exposed out of a Brucella cell in a Omp16 molecule, has the TLR4 activating activity, and is free of Lipobox (the Lipobox is lowly toxic or completely nontoxic). Mice are subjected to an immunity virus attacking test through the Omp16<26-168>/Sao<28-138> fusion protein, it is shown that the Omp16<26-168>/Sao<28-138> fusion protein has the good immune protection effect, a quite-high cellular immune response and a quite-high humoral immune response can be induced, but a Th1 response is the main response, and the fusion protein has the self-adjuvant effect, is an ideal vaccine antigen of streptococcus, and has the important value in development and application aspects of novel vaccine.

The invention relates to a method of treating an excessive immune response including an aberrant/enhanced Th1 response by administering a helminthic parasite preparation in an amount sufficient to reduce the excessive immune response in an individual. This invention is generally directed to autoimmune diseases which involve an excessive immune response or an aberrant/enhanced Th1 response. More specifically, the present invention is directed to the treatment of Crohn's disease and ulcerative colitis, both known as IBD. While the present invention discloses specific information about the treatment of IBD, the disclosure is in no way limiting. Additionally, rheumatoid arthritis, type 1 diabetes mellitus, lupus erythematosis, sarcoidosis and multiple sclerosis can be treated by the methods and compositions disclosed therein.

The present invention relates to methods for treating autoimmune disorders. In an embodiment, the invention is directed to a method for treating an autoimmune disorder comprising administering a TCCR agonist. In an embodiment, the autoimmune disorder is at least partially mediated by a Th1 response. In an embodiment, the autoimmune disorder is at least partially mediated by CD8⁺ T-cell proliferation.