A dual-functional material targeting antibacterial and in situ promoting bone formation and its preparation method and application
A dual-functional material and bone-promoting technology, which is applied in the field of periodontal tissue repair and regeneration, can solve the problems of reduced patient comfort and compliance, failure, poor treatment effect, etc., and achieve long-acting targeted antibacterial and in situ promotion Effect of regeneration and promotion of periodontal tissue regeneration
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0041] In yet another specific embodiment of the present invention, the preparation method of the above-mentioned targeted antibacterial and in situ bone-promoting bifunctional material is provided, the preparation method comprising: polyethylene glycol diacrylate, SDF-1 and functional polypeptide modules Mix well and serve.
[0042] In yet another specific embodiment of the present invention, the preparation method is carried out by a secondary mixing method, that is, after mixing polyethylene glycol diacrylate and SDF-1, and then adding a functional polypeptide module for mixing, at this time, the poly Ethylene glycol diacrylate undergoes Michael addition reaction with functional polypeptide modules and forms a thermosensitive gel. Tests have proved that the gel solution is in a liquid state at room temperature (25°C), and when transferred to an environment at 37°C, it can be automatically cross-linked into a hydrogel state within 30 minutes.
[0043] Wherein, the mass rati...
Embodiment
[0058] Experimental materials and methods:
[0059] (1) Preparation and characterization of PEG-DA-Peptide@SDF-1 bifunctional material
[0060] 1. Development and preparation of functional polypeptide modules: A peptide chain with a total length of 30 amino acids was synthesized de novo by using the solid-phase peptide synthesis method. The amino acid sequence of the peptide chain is: CGPQRIWGQCGGVVFGVGFGCGPQRIWGQC (SEQ ID NO.1). These include anchor short peptides of 10 amino acids-short antimicrobial peptides of 10 amino acids-anchor short peptides of 10 amino acids.
[0061] 2. Preparation of polyethylene glycol diacrylate: In a three-neck flask equipped with a water separator, heat 0.1mol of PEG20000 (the polymerization inhibitor is 0.3g of hydroquinone) to 70 degrees Celsius, and then add 0.3 mol of acrylic acid and 4g of p-toluenesulfonic acid were stirred. After the temperature was raised to 110 degrees Celsius, the reflux reaction was maintained for 2 hours, and then...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 



