Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A dual-functional material targeting antibacterial and in situ promoting bone formation and its preparation method and application

A dual-functional material and bone-promoting technology, which is applied in the field of periodontal tissue repair and regeneration, can solve the problems of reduced patient comfort and compliance, failure, poor treatment effect, etc., and achieve long-acting targeted antibacterial and in situ promotion Effect of regeneration and promotion of periodontal tissue regeneration

Active Publication Date: 2021-08-03
SHANDONG UNIV
View PDF7 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, the inventors found that during the long periodontitis clinical treatment period, due to the lack of plasticity of the bracket material, the poor adaptability and the inability to fully fill the periodontal defect, the patient's comfort and compliance with treatment often decrease, resulting in Poor or even failure of treatment

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A dual-functional material targeting antibacterial and in situ promoting bone formation and its preparation method and application
  • A dual-functional material targeting antibacterial and in situ promoting bone formation and its preparation method and application
  • A dual-functional material targeting antibacterial and in situ promoting bone formation and its preparation method and application

Examples

Experimental program
Comparison scheme
Effect test

preparation example Construction

[0041] In yet another specific embodiment of the present invention, the preparation method of the above-mentioned targeted antibacterial and in situ bone-promoting bifunctional material is provided, the preparation method comprising: polyethylene glycol diacrylate, SDF-1 and functional polypeptide modules Mix well and serve.

[0042] In yet another specific embodiment of the present invention, the preparation method is carried out by a secondary mixing method, that is, after mixing polyethylene glycol diacrylate and SDF-1, and then adding a functional polypeptide module for mixing, at this time, the poly Ethylene glycol diacrylate undergoes Michael addition reaction with functional polypeptide modules and forms a thermosensitive gel. Tests have proved that the gel solution is in a liquid state at room temperature (25°C), and when transferred to an environment at 37°C, it can be automatically cross-linked into a hydrogel state within 30 minutes.

[0043] Wherein, the mass rati...

Embodiment

[0058] Experimental materials and methods:

[0059] (1) Preparation and characterization of PEG-DA-Peptide@SDF-1 bifunctional material

[0060] 1. Development and preparation of functional polypeptide modules: A peptide chain with a total length of 30 amino acids was synthesized de novo by using the solid-phase peptide synthesis method. The amino acid sequence of the peptide chain is: CGPQRIWGQCGGVVFGVGFGCGPQRIWGQC (SEQ ID NO.1). These include anchor short peptides of 10 amino acids-short antimicrobial peptides of 10 amino acids-anchor short peptides of 10 amino acids.

[0061] 2. Preparation of polyethylene glycol diacrylate: In a three-neck flask equipped with a water separator, heat 0.1mol of PEG20000 (the polymerization inhibitor is 0.3g of hydroquinone) to 70 degrees Celsius, and then add 0.3 mol of acrylic acid and 4g of p-toluenesulfonic acid were stirred. After the temperature was raised to 110 degrees Celsius, the reflux reaction was maintained for 2 hours, and then...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a dual-functional material targeting antibacterial and in situ osteogenesis, a preparation method and application thereof, and belongs to the technical field of periodontal tissue repair and regeneration. The bifunctional material includes a thermosensitive gel scaffold formed by cross-linking PEG-DA and Peptide and capable of responding to gingivalin, and SDF-1, which is further loaded with the material, has the function of recruiting stem cells and homing. The developed and prepared gingivalin-responsive thermosensitive gel material can simultaneously achieve long-term targeted antibacterial and in situ regeneration promotion of periodontal defects along with the release of short antimicrobial peptides and SDF‑1. Tests have proved that the PEG-DA-Peptide@SDF-1 bifunctional material prepared by the present invention is injectable and has good long-term targeted antibacterial and in-situ regeneration promotion effects, so it has good practical application value.

Description

technical field [0001] The invention belongs to the technical field of periodontal tissue repair and regeneration, and in particular relates to a dual-functional material targeting antibacterial and in situ osteogenesis, and a preparation method and application thereof. Background technique [0002] The information disclosed in this background section is only intended to increase the understanding of the general background of the present invention, and is not necessarily taken as an acknowledgment or any form of suggestion that the information constitutes the prior art already known to those skilled in the art. [0003] Periodontitis is a periodontal disease caused by the infection of various anaerobic pathogenic bacteria such as Porphyromonas gingivalis (P. the main reason. Periodontitis not only causes gum bleeding, ulceration and loose teeth, but also is closely related to systemic diseases such as diabetes and Alzheimer's disease. Periodontal tissue engineering is curr...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/00A61L27/18A61L27/22A61L27/50A61L27/52
CPCA61L27/18A61L27/227A61L27/50A61L27/52A61L27/54A61L2300/252A61L2300/404A61L2300/414A61L2400/06A61L2430/12C08L71/02C08L89/00
Inventor 葛少华刘世岳王亚楠商玲玲刘红蕊
Owner SHANDONG UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com