Unlock instant, AI-driven research and patent intelligence for your innovation.

An immunosorbent assay for differentiating HIV-1 recent from chronic infection

A chronic infection and screening technology, applied in measurement devices, analytical materials, instruments, etc., can solve problems such as not fully applicable to new HIV infections, high technical requirements for technical personnel, and synthesis of antigenic materials.

Active Publication Date: 2021-06-15
SOUTHERN MEDICAL UNIVERSITY
View PDF3 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, BED-CEIA has been discontinued due to the synthesis of antigenic materials.
[0009] In addition, these two methods have the following shortcomings in application: (1) Parekh et al. showed that when partial peptides of gp41 of HIV-1B and E subtypes were used as detection antigens, the reaction intensity with blood samples of the same subtype was higher than that of other subtypes. blood type high
The genotypes targeted by existing methods include A, B, C, F, G, H, I, K, AG, AB, AC, BG, AE, D and AD, and the molecular epidemiological survey of HIV in my country shows that my country The main prevalent genotypes are CRF01_AE, CRF07_BC, CRF08_BC and B subtypes. The existing methods are not fully suitable for the detection of new HIV infections in my country and need to be improved and perfected
(2) The existing method based on the recent infection window period and correction coefficient obtained from subtype B blood samples is not completely suitable for the actual situation of multi-subtype epidemics in my country. It is necessary to obtain the corresponding window period in combination with the epidemic background in my country to improve the new infection rate The correction coefficient can accurately calculate the new HIV infection rate in my country
(3) Existing methods have strict limits on the test results of quality control samples, require high technical personnel to operate, and require two experimental operations for primary screening and confirmation, which is not conducive to the prevalence of new HIV-1 infection rates in large-scale populations scientific survey
(4) Existing methods are not clear about gp41 protein as an epitope for recent infection detection, and further research is needed to clarify its possible mechanism of action

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • An immunosorbent assay for differentiating HIV-1 recent from chronic infection
  • An immunosorbent assay for differentiating HIV-1 recent from chronic infection
  • An immunosorbent assay for differentiating HIV-1 recent from chronic infection

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0044] A transmembrane glycoprotein gp41 contains 57 amino acid sequences, which are used for distinguishing HIV recent infection from chronic infection. Taking HIV-1 virus strain HXB2 (GenBank accession number K03455) as a reference, the amino acid sequence positions are 560-616aa.

[0045] One of the transmembrane glycoprotein gp41 has 57 amino acid sequences as polypeptide 01AE-P57, which is used to screen HIV-1 CRF01_AE gene subtype blood samples for recent and chronic infection. HIV-1 strain HXB2 (GenBank accession number is K03455) is used as For reference, its amino acid sequence position is 560-616aa, and its amino acid sequence is EAQQHLLQLTVWGIKQLQARVLAVERYLKDQKFLGLWGCSGKIICTTAVPWNSSWSN.

[0046] Among them, 57 amino acid sequences in the transmembrane glycoprotein gp41 are polypeptide 07BC-P57, which is used to screen HIV-1 CRF07_BC and CRF08_BC gene subtype blood samples for recent and chronic infection, and HIV-1 virus strain HXB2 (GenBank accession number is K0345...

Embodiment 2

[0052] A fusion protein for screening HIV-1 CRF01_AE, CRF07_BC, CRF08_BC, B and D five genotype blood samples newly and chronically infected, connected by protein linking peptide GGGGSGGGGS, fusion expression 01AE-P57, 07BC-P57, B- P57和D-P57四个肽段,融合表达蛋白的具体氨基酸序列为EAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNGGGGSGGGGSEAQQHLLQLTVWGIKQLQTRVLAIERYLKDQQLLGIWGCSGKLICTTAVPWNSSWSNGGGGSGGGGSEAQQHLLQLTVWGIKQLQARVLAVERYLKDQKFLGLWGCSGKIICTTAVPWNSTWSNGGGGSGGGGSEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKHICTTNVPWNSSWSN。

Embodiment 3

[0054]A serological antibody immunosorbent assay for differentiating recent and chronic HIV-1 infection, such as figure 1 As shown, HIV-1 CRF01_AE, CRF07_BC, CRF08_BC, B and D five gene subtypes transmembrane glycoprotein gp41 were selected as the fusion expression of 57 amino acids as the detection antigen to capture the specific anti-HIV antibody in the test sample and remove non-specific or Low-affinity anti-HIV antibody, by detecting the optical density value of the blue substance produced by the substrate catalyzed by horseradish peroxidase, the presence and content of HIV antibody representing HIV chronic infection in the sample to be tested can be judged, and the measured object can be judged to be in the Recent or chronic HIV infection.

[0055] Among them, the immunosorbent detection method for distinguishing between recent and chronic HIV-1 infection includes the following steps:

[0056] S1. Analyze the genotype of the target HIV. The optimal detection antigens of ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

A serological antibody immunosorbent assay for distinguishing HIV-1 recent and chronic infection, fusion expression MP4 containing partial peptides of HIV-1 B, D, CRF01_AE, CRF07_BC, CRF08_BC transmembrane protein As the detection antigen, the specific antibody representing chronic HIV infection in the sample to be tested is captured, and the optical density value of the blue substance produced by the horseradish peroxidase catalyzed substrate TMB is detected to determine the antibody representing chronic HIV infection in the sample to be tested. Presence and content of anti-HIV antibodies. The fusion-expressed tetravalent polypeptide is used as the detection antigen, which can simultaneously detect multiple HIV genotypes, so that the detection range is wider, and the sensitivity and specificity are higher. The classic ELISA indirect method is used for detection, and the operation is relatively simple. It is more useful in the evaluation of control measures and epidemiological surveys of new infection rates in HIV-1 populations.

Description

technical field [0001] The invention belongs to the field of biotechnology, and in particular relates to the establishment of an immunosorbent detection method for distinguishing human immunodeficiency virus type 1 (humanimmunodeficiency virus type 1, HIV-1) from chronic infection, and in high-throughput HIV-1 infection epidemiological investigations and monitoring applications. Background technique [0002] Human immunodeficiency virus (human immunodeficiency virus, HIV) is also known as AIDS virus, and the AIDS caused by it is a chronic fatal infectious disease raging around the world. According to the report of the World Health Organization, as of the end of 2016, there were 36.7 million HIV-infected people in the world. Since the virus was discovered in the past 30 years, it has caused more than 35 million deaths. It seriously endangers public health and is a major public health problem facing the world. [0003] According to the length of time after HIV infection and t...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): G01N33/569
CPCG01N33/56983
Inventor 唐时幸蔡群娣王海鹰李秀芬
Owner SOUTHERN MEDICAL UNIVERSITY
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More