A kind of dendritic cell inducer and its preparation method and application
A dendritic cell and inducer technology, applied in the field of nano-immune drugs, can solve the problems of loss of immunosuppressive function, low ability of body migration and homing, and impaired cell activity, etc., achieve adjustable surface physical and chemical properties, and increase clinical promotion And the possibility of application, the effect of low price
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0053] Embodiment 1. Preparation of monolayer graphene oxide (graphene oxide, GO) with different sheet diameters
[0054] The graphene oxide used in the present invention can be prepared by referring to the prior art. It can be a two-dimensional nanomaterial with a sheet structure obtained by oxidation of graphene with a strong oxidant (such as potassium permanganate), or after the oxidation reaction of potassium permanganate in concentrated sulfuric acid and graphite powder, a brown in There are graphite flakes with derivatized carboxyl groups on the edge and mainly phenolic hydroxyl groups and epoxy groups on the plane. This graphite flake layer can be exfoliated into graphene oxide by ultrasonic or high-shear vigorous stirring, and forms a stable, light brown yellow in water. Monolayer graphene oxide suspension.
[0055] The following is a specific example to illustrate how to obtain graphene oxide with different sheet diameters:
[0056] 1g graphite flakes, 1g NaNO 3 , ...
Embodiment 2
[0065] Example 2. Culture and identification of immature dendritic cells derived from mouse bone marrow
[0066] 1. Culture and induction of immature dendritic cells derived from mouse bone marrow
[0067] Kill L2G85.C57BL / 6J mice (6-8 weeks) by cervical dislocation, soak them in 75% (v / v) alcohol and place them in an ultra-clean workbench to separate their femurs and tibias, soak them in PBS, and use aseptic Remove the muscle and epiphysis with scissors and tweezers, blow out the bone marrow in the bone marrow cavity with a 2mL syringe needle, absorb 1640 medium and wash the bone marrow cavity repeatedly until the bone marrow cavity turns white. Gently blow off the bone marrow cells with a syringe and filter through a 40 μm filter into a centrifuge tube.
[0068] Dispersed bone marrow cells were divided into 2 × 10 6 The cells / mL were cultured in a 6-well plate, and 1640 complete medium (containing 10 wt% fetal calf serum, 5 ng / mL IL-4, 10 ng / mL GM-CSF) was added to each we...
Embodiment 3
[0072] Example 3. Screening of neuropeptides
[0073] (1) Four neuropeptides inhibit DCs from secreting pro-inflammatory cytokines
[0074] The four neuropeptides UCN, α-MSH, VIP and AM were entrusted to Shanghai Gil Biochemical Company to process and produce them and were purified by high-performance liquid chromatography. HSDAVFTDNYTRLRKQMAVKKYLNSILN), cortistatin AM (YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY), melanocyte stimulating hormone releasing factor α-MSH (SYSMEHFRWGKPV).
[0075] Using UCN, α-MSH, VIP and AM four neuropeptides (respectively UCN-DCs group, VIP-DCs group, α-MSH-DCs group and AM-DCs group) to 10 -7 The immature dendritic cells were co-incubated at the final concentration of mol / L for 48 hours, and at the same time, a low dose of lipopolysaccharide (lipopolysaccharide, LPS) (200ng / ml) was given to stimulate the immature dendritic cells in a co-incubation manner, so as not to be treated with neuropeptides and given a low dose of LPS Stimulate...
PUM
Property | Measurement | Unit |
---|---|---|
size | aaaaa | aaaaa |
size | aaaaa | aaaaa |
size | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com