Monoclonal antibody specifically binding to human CD47 and application thereof
A monoclonal antibody and multispecific antibody technology, applied in the fields of antibody, application, anti-animal/human immunoglobulin, etc., can solve the problems of specific antibody to be studied, rapid antibody consumption, low blood drug concentration, etc., to achieve Good anti-tumor efficacy, good anti-tumor efficacy
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0075] Example 1: Sources of Antigen and Control Antibodies
[0076] Using the extracellular region (19-136aa) of human CD47 as the target antigen, we constructed the transient samples of unlabeled CD47 (crystallization experiment), CD47-his, CD47-mutC15G-his, CD47-mFc, CD47-hFc and SIRPα-mFc respectively. Expression vectors to obtain various forms of recombinant antigens and related identification proteins. A variety of human tumor cell lines that highly express CD47, such as CCRF-SB, U937, SKOV-3, A431, etc., are used for in vitro binding, blocking and in vivo pharmacodynamic evaluation.
[0077] Referring to the sequence disclosed in the patent, the following antibodies were prepared as reference antibodies, all in the form of IgG4. FortySeven's clinical research antibody hu5F9 (US2015 / 0183874A1, hu5F9V2, light and heavy chain variable region sequences: SEQ ID NO.1 and SEQ ID NO.2), Surface Oncology's SRF-231 (WO2017 / 053423A1, 2.3D11, light and heavy chain can be Variable...
Embodiment 2
[0091] Example 2: Anti-human CD47 antibody hybridoma antibody and chimeric antibody
[0092] Hybridoma production was performed by immunizing Balb / c mice with CD47-mFc. Serum antibody titers were detected 34 days or 57 days after the primary immunization, respectively. Select mice whose serum titer meets the requirements of the fusion experiment (serum antibody titer: 1:102400). Splenocytes and myeloma cells FO in an appropriate ratio (5:1) are fused under the action of a fusion agent to prepare hybridomas Monoclonal cells. Hybridoma cells were cultured in selective medium R1640-HAT, and 651 hybridoma supernatant samples were detected by ELISA on days 10-14, including cell binding activity (FACS), CD47 / SIPRα blocking, As well as the cross-reaction with recombinant cyno-CD47-mFc, clones 597 and 439 were screened out. The above cloned light and heavy chain variable region genes were obtained, and the light and heavy chain variable region genes were cloned into a recombinant e...
Embodiment 3
[0105] Example 3. Humanization and Transformation
[0106] 3.1 Affinity detection of humanized 439
[0107] The humanization design of 439 was carried out, and IGKV3-7|IGKJ4 and IGHV1-3*01|IGHJ1*01 were selected as germline templates for the light and heavy chains of 439, respectively. See SEQ ID NO.13 and SEQ ID NO.14 for the light and heavy chain sequences of Hz439 after humanization.
[0108] SEQ ID NO.13:Hz439 light chain amino acid sequence
[0109] ENVLTQSPPTLSLSPGERATLSCRASSSVSSSYFHWYQQKPGQAPRLLIYGTSTLASGIPARFSGSGSGTDYTLTISSLQPEDAAVYYCQQYSGYPYTFGGGTKVEIKR
[0110] SEQ ID NO.14:Hz439 heavy chain amino acid sequence
[0111] QVQLVQSGAEVKKPGASVKVSCKASGYTFSRYWIEWVRQAPGQRLEWMGEILPGDVQTSYNEKFKGRVTITADTSASTAYMELSSLRSEDTAVYYCARGGLRRFDYWGQGTLVTVSS
[0112] The affinity of 439 with recombinant CD47-His after humanization was detected, and the dissociation was carried out after binding for 300s. The results are as follows figure 2 , as shown in Table 2, the affinity of t...
PUM

Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com