Cool sweat-absorbing summer clothing fabric
A fabric and clothing technology, applied in the field of cool and sweat-absorbing summer clothing fabrics, can solve the problems of insufficient softness of the fabric, narrow application range, and unsuitability for ordinary clothing, etc., and achieve good anti-wrinkle effect, convenient operation and control, and excellent moisture absorption and moisture conduction performance Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0015] A cool and sweat-absorbing summer clothing fabric. The production method includes preparation of modified bamboo fiber, preparation of blended yarn, preparation of base fabric, heat setting, preparation of finishing liquid, and finishing. The specific steps are:
[0016] 1) Preparation of modified bamboo fiber: Bamboo fiber is impregnated with Teflon solution with a concentration of 22g / L. The Teflon solution contains active polypeptide with a weight fraction of 0.035wt%, and the bath ratio is 1:42. 73%, dehydrated, dried at 98°C for 23 minutes, then baked at 110°C for 5 minutes, the amino acid sequence of the active polypeptide is HSHACKLCVCVNCFCCGCYLCRVLHPGKLCCSK, one end of the active polypeptide is a hydrophilic group, which can destroy the cell wall in bamboo fiber , change the osmotic pressure of the bamboo fiber, promote the Teflon solution to enter the fiber, modify the fiber, and have no toxic side effects, no skin irritation, and no pollution to the environment...
Embodiment 2
[0023] A cool and sweat-absorbing summer clothing fabric. The production method includes preparation of modified bamboo fiber, preparation of blended yarn, preparation of base fabric, heat setting, preparation of finishing liquid, and finishing. The specific steps are:
[0024]1) Preparation of modified bamboo fiber: Bamboo fiber is impregnated with Teflon solution with a concentration of 20g / L. The Teflon solution contains active polypeptide with a weight fraction of 0.05wt%, and the bath ratio is 1:42. 76%, dehydrated, dried at 98°C for 22 minutes, then baked at 108°C for 6 minutes, the amino acid sequence of the active polypeptide is HSHACKLCVCVNCFCCGCYLCRVLHPGKLCVCNCSK, one end of the active polypeptide is a hydrophilic group, which can destroy the cell wall in bamboo fiber , change the osmotic pressure of the bamboo fiber, promote the Teflon solution to enter the fiber, modify the fiber, and have no toxic side effects, no skin irritation, and no pollution to the environmen...
Embodiment 3
[0031] Performance test of cool and sweat-absorbing summer clothing fabrics:
[0032] The fabrics of Example 1 and Example 2 were set as the test group, and common commercially available fabrics were set as the control group, and the cool and refreshing feeling test and the sweat absorption test were carried out respectively.
[0033] Cooling feeling test: The contact cooling and warming feeling tester takes the instant cooling feeling Q-max as an index: the degree of cooling feeling is calculated by simulating the change of heat generated after the hand touches the fabric, and the calculation results are shown in Table 1.
[0034] Sweat absorption test: refer to "GB / T 14576-2009 Textile Color Fastness Test Light Fastness, Sweat Composite Color Fastness" to prepare sweat, put the fabric to be tested in sweat and completely wet it for 5 minutes, take it out and hang it naturally, when two drops of water fall When the time interval exceeds 30s, it can be considered that the samp...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 