Tissue repair protein CHRD, and coding gene and applications thereof
A technology that encodes genes and proteins, which is applied in the fields of biomedicine and daily necessities, can solve problems such as unsatisfactory application, secondary trauma of wounds, and insufficient fluid absorption, and achieve significant repair effects, effective repair, and improved healing speed Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0038] Example 1. CHRD gene design and protein expression
[0039] 1. Genetic design
[0040] The inventor designed a gene whose nucleotide sequence is shown in Sequence 2 in the sequence listing, with a full length of 1719bp. The gene encodes a protein whose amino acid sequence is shown in Sequence 1 in the sequence table, with a total length of 572 amino acids, and is named CHRD protein. Sangon Bioengineering (Shanghai) Co., Ltd. was entrusted to carry out the whole gene synthesis of the gene and added Ndel restriction site (CATATG) and Xhol restriction site (CTCGAG) at the 5' end and 3' end of the gene respectively. The gene sequence with restriction sites is shown as sequence 3 in the sequence listing. The synthesized gene was sequenced and verified, and the gene with the correct sequence was used for subsequent vector construction.
[0041] Amino acid sequence of CHRD (572aa)
[0042]MSSGVDLGTENLYFQSNAMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRKKMKGVQLKL...
Embodiment 2
[0065] Example 2. Wound healing performance evaluation of CHRD protein
[0066] 1. Evaluation of wound healing effect of pure skin
[0067] Male SD rats with a body weight of 250-300 g were selected to create a back full dermal trauma model. Nine SD rats were randomly divided into 3 groups, 3 in each group, wherein 2 groups were used as the experimental group, and 1 group was used as the control group, anesthetized by intraperitoneal injection of chloral hydrate (10wt%) (0.5mL / 100g). Under aseptic conditions, after the back is shaved and routinely disinfected, create a 1.0×1.0cm spine with the spine as the midline 2 The size of the skin excision wound. The two experimental groups were repaired with gauze and CHRD powder respectively, in which the gauze group used sterile gauze to bind the wound (gauze was changed every 3 days), and the CHRD group was evenly applied on the wound with CHRD powder (the dressing was changed every 3 days). ). The control group exposed the wound...
Embodiment 3
[0076] Example 3. Biosafety evaluation of CHRD protein
[0077] MTT method was used to study the toxicity of CHRD protein to mouse fibroblast L929 (Cell Bank of Type Culture Collection Committee, Chinese Academy of Sciences) to evaluate the biological safety of CHRD protein. Mouse fibroblast L929 cells were used at 1×10 4 The concentration / well was inoculated into DMEM medium (Beijing Soleibao) in a 96-well plate. Five experimental groups and one control group were set up, and three replicate holes were set up for each group. After culturing the cells at 37°C for 24 hours, CHRD protein was added to the wells of the experimental group, so that the final concentrations of CHRD protein in the five experimental groups were 50 mg / L, 100 mg / L, 200 mg / L, 400 mg / L, and 800 mg / L. The control group did not add CHRD protein. Continue culturing at 37°C for 24 hours, and then use the MTT method to detect the number of viable cells, as follows: add 10 μl of MTT solution (5 mg / ml) to each...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



