Targeted antibiosis and in-situ osteogenesis promoting bifunctional material as well as preparation method and application thereof
A dual-functional material and bone-promoting technology, which can be used in pharmaceutical formulations, prostheses, drug delivery, etc., can solve problems such as poor treatment effect, inability to fully fill periodontal defects, and reduced patient comfort and compliance
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0041]In another specific embodiment of the present invention, there is provided a preparation method of the above-mentioned targeted antibacterial and in-situ bone formation dual-functional material. The preparation method comprises: combining polyethylene glycol diacrylate, SDF-1 and functional polypeptide module Mix well and get it.
[0042]In another specific embodiment of the present invention, the preparation method adopts a secondary mixing method, that is, after mixing polyethylene glycol diacrylate and SDF-1, the functional polypeptide module is added for mixing. The ethylene glycol diacrylate and the functional peptide module undergo a Michael addition reaction and form a temperature-sensitive gel. Tests have proved that the gel solution is liquid at room temperature (25°C). When transferred to an environment of 37°C, it can automatically crosslink into a hydrogel state within 30 minutes.
[0043]Wherein, the mass ratio of the polyethylene glycol diacrylate, SDF-1 and functional...
Embodiment
[0058]Experimental material method:
[0059](1) Preparation and characterization of PEG-DA-Peptide@SDF-1 bifunctional material
[0060]1. Development and preparation of functional peptide module: Using solid-phase peptide synthesis, a peptide chain with a total length of 30 amino acids was synthesized de novo. The amino acid sequence of the peptide chain is: CGPQRIWGQCGGVVFGVGFGCGPQRIWGQC (SEQ ID NO. 1). Including 10 amino acid anchor short peptide-10 amino acid short antimicrobial peptide-10 amino acid anchor short peptide.
[0061]2. Preparation of polyethylene glycol diacrylate: In a three-necked bottle equipped with a water separator, heat 0.1 mol of PEG20000 (the polymerization inhibitor is 0.3 g of hydroquinone) to 70 degrees Celsius, and then add 0.3 mol of acrylic acid and 4 g of p-toluenesulfonic acid were stirred. After the temperature was raised to 110 degrees Celsius, the reflux reaction was maintained for 2 hours, and then the temperature was raised to 120 degrees Celsius until ...
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com