Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Albumin HSA-Hydrophobic-IIB with self-assembly performance and application thereof

A technology of albumin and recombinant bacteria, applied in the field of biomedicine, can solve the problems of limited drug application range, low solubility, difficult absorption, etc.

Pending Publication Date: 2022-04-01
CHONGQING UNIV
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

On the other hand, a considerable part of the drugs currently on the market are hydrophobic drugs, which have extremely low solubility in water, are difficult to be effectively absorbed by the body, and have limited application ranges.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Albumin HSA-Hydrophobic-IIB with self-assembly performance and application thereof
  • Albumin HSA-Hydrophobic-IIB with self-assembly performance and application thereof
  • Albumin HSA-Hydrophobic-IIB with self-assembly performance and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0032] Example 1. HSA-Hydrophobic-IIB gene design and protein expression

[0033] 1. Genetic design

[0034] The inventor designed a gene, the nucleotide sequence of which is shown in SEQ ID No.2, with a full length of 1779bp. The gene encodes a protein whose amino acid sequence is shown in SEQ ID No.1, with a total length of 592 amino acids, named HSA-Hydrophobic-IIB novel albumin. Sangon Bioengineering (Shanghai) Co., Ltd. was entrusted to carry out the whole gene synthesis of the gene and added NdeI restriction site (CATATG) and XhoI restriction site (CTCGAG) to the 5' end and 3' end of the gene respectively. The gene sequence with restriction sites is shown in SEQ ID No.3. The synthesized gene was sequenced and verified, and the gene with the correct sequence was used for subsequent vector construction.

[0035] Amino acid sequence of HSA-Hydrophobic-IIB (592aa)

[0036]MDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERN...

Embodiment 2

[0060] Example 2. Preparation of Nanomicelles of Natural Human Serum Albumin (ori-HSA)

[0061] The amino acid sequence of native human serum albumin (ori-HSA) is shown in SEQ ID No.4, with a total length of 591 amino acids; NdeI enzyme cleavage sites (CATATG ) and XhoI restriction site (CTCGAG), to obtain the gene whose nucleotide sequence is shown in SEQ ID No.5, the full length is 1788bp. Sangon Bioengineering (Shanghai) Co., Ltd. was commissioned to synthesize the gene, and the synthesized gene was sequenced and verified, and the gene with the correct sequence was used for subsequent vector construction.

[0062] The methods of prokaryotic expression vector construction, transformation, protein expression and purification of native human serum albumin (ori-HSA) are consistent with the methods of prokaryotic expression vector construction, transformation, protein expression and purification of HSA-Hydrophobic-IIB novel albumin, detailed The steps are the same as 2-4 in Exa...

Embodiment 3

[0064] Example 3. Cytotoxicity evaluation of HSA-Hydrophobic-IIB novel albumin

[0065] The toxicity of HSA-Hydrophobic-IIB new albumin to human embryonic kidney cell 293T (Cell Bank of Type Culture Collection Committee, Chinese Academy of Sciences) was studied by CCK8 method to evaluate the biological safety of the new albumin HSA-Hydrophobic-IIB. In a 96-well plate, inoculate 1×10 per well 4 Human embryonic kidney cells 293T were placed in DMEM medium (gibco), and 5 experimental groups and 1 control group were set up, and 3 replicate wells were set up for each group. After culturing the cells at 37°C for 24 hours, add HSA-Hydrophobic-IIB new albumin to the wells in the experimental group (experimental wells), so that the final concentrations of HSA-Hydrophobic-IIB new albumin in the five experimental groups were 10 μg / ml , 50 μg / ml, 100 μg / ml, 200 μg / ml, 400 μg / ml. In the wells of the control group (control wells), HSA-Hydrophobic-IIB novel albumin was not added. Continue...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of biological medicines, and particularly relates to albumin HSA-Hydrophobic-IIB with a self-assembly property and an application of the albumin HSA-Hydrophobic-IIB. The amino acid sequence of the provided albumin is as shown in SEQ ID No. 1. The albumin can be self-assembled to form nanoparticles, the obtained nanoparticles are uniform in morphology, and the average particle size is 115.4 nm. Cell experiments show that the albumin has good biocompatibility. A drug release experiment shows that the albumin nano-micelle has a remarkable drug slow release effect.

Description

technical field [0001] The invention belongs to the technical field of biomedicine, and in particular relates to an albumin HSA-Hydrophobic-IIB with self-assembly performance and its application in preparing nano micelles for delivery of hydrophobic drugs. Background technique [0002] Human serum albumin (HSA) is the most abundant protein in human plasma, accounting for about 50% of the total protein in plasma, with a concentration of 38-48g / L. Human liver can synthesize 12-20g of albumin every day. HSA consists of 585 amino acid residues, with a molecular weight of about 67kDa. Its single-molecule conformation is a "heart-shaped" structure, which is mainly divided into three domains, I, II, and III, and each domain is divided into two subdomains. , namely IA and IB, IIA and IIB, IIIA and IIIB. Because albumin is derived from human plasma, it has good biocompatibility, and because of its advantages such as good biodegradability, high biostability, extremely low cytotoxicit...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/765C12N15/30C12N15/70C12N1/21A61K9/107A61K47/42B82Y5/00C12R1/19
CPCY02A50/30
Inventor 郝石磊孟润王伯初邓佩颖祝连彩
Owner CHONGQING UNIV
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com