Method for rapidly detecting activity of CD19/CD20-CAR-T cells
A technology of CD20-CAR-T and cell activity, which is applied in the field of immune cell and its activity measurement, can solve the problems of time-consuming and unclear guidance
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0043] Example 1. Construction of NFAT-RE-luciferase-K562 stably transfected cell lines
[0044] NFAT-RE-luciferase-K562 effector cells are K562 cells driven with NFAT-RE for luciferase expression, responsive to CD3 but not CD28 stimulation.
[0045] 1) Construction and packaging of NFAT-RE-luciferase lentiviral plasmid
[0046] The sequence of the CD19 / CD20 antibody in NFAT-RE was obtained by us through phage screening technology. It was expressed in the lentiviral plasmid pMDL through genetic recombination based on engineering and luciferase luciferase disclosed in the UNIPROT database, and 293 cells were used for viral isolation. Pack and collect.
[0047] Amino acid sequence of CD19 antibody:
[0048] LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRD...
Embodiment 2
[0058] Example 2. NFAT-RE-luciferase-K562 stably transfected cell line is used to evaluate the activity of CD19 / CD20 CAR-T receptor
[0059] 1) Raji cell culture
[0060]Raji is a tumor cell that highly expresses CD19 antigen. Resuscitate Raji cells from a liquid nitrogen tank with 10% newborn calf serum, 100 U / ml penicillin, 100 U / ml streptomycin, 2.5 g / L glucose, 0.11 g / L sodium pyruvate, 1.5 g / L Raji cells were cultured in RPMI 1640 medium with sodium bicarbonate, pH 7.2, 5% CO2, 37 °C, and 90% relative humidity, and passaged once every 2 days.
[0061] 2) Activity detection of NFAT-RE-luciferase-K562 stably transfected cell line
[0062] Raji cells and NFAT-RE-luciferase-K562 were mixed and cultured according to different ratios. After co-cultivation for 4 hours, the fluorescence signal intensity of K562 cells was detected by a microplate reader, and the affinity of the antigen was judged according to the difference in the fluorescence intensity produced by K562 cells. ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 

