13results about How to "Enables direct detection" patented technology

The application relates to the technical field of new energy vehicles and vehicle detection equipment, and discloses a portable device for heavy truck axle housing liquid level measurement, which is suitable for electric drive axle and traditional drive axle. The device comprises a shell support structure, an electronic control assembly, a posture adjusting execution mechanism, a quick locking connection mechanism and a liquid level measurement assembly; the shell support structure is used for supporting the device and stretching and retracting the measurement assembly; the electronic control assembly is used for power supply, control and result display; the posture adjusting execution mechanism is used for adjusting the posture of the measurement assembly to keep it vertical; the quick locking connection mechanism is used for quickly fixing the device and the oil filling hole of the axle housing; and the liquid level measurement assembly realizes liquid level detection by cooperating a magnetic float and a Hall sensor. The application takes into account the application requirements of the electric drive axle and the traditional drive axle, and can especially meet the requirements of the electric drive axle on liquid level detection precision and reliability.

The invention discloses a probe for targeting staphylococcus aureus and an application of the probe. The amino acid sequence of a nano antibody is as follows: QLQLVESGGLVQAGGSMRLSCAASGRTFSTNTMGWFRQAPGKEREFVAGIRWISGSTQADSVKGRFTISRDNAKNTLFLQMNSLPEDAVYYCAAGPHNIPILRTSAYNYWGQGTQVTVSS, and the amino acid sequence of the nano antibody is as follows: QLQLVEGGGLVQAGGTQVTVSS. According to the invention, a high-performance probe is screened, and a high-sensitivity electrochemical sensor is constructed to realize rapid and accurate screening of staphylococcus aureus in different media; staphylococcus aureus can be qualitatively detected within one minute, and the method has high sensitivity and excellent specificity and accuracy. The method meets the urgent demand of accurately, reliably and quickly detecting the staphylococcus aureus in a complex environment.

The utility model discloses a kind of test box for airplane cargo hold fire bottle trigger circuit, including test shell, supporting mechanism, controller and acquisition connector.The test box for airplane cargo hold fire bottle trigger circuit utilizes acquisition connector to butt joint the trigger circuit of fire bottle, the voltage data of the trigger circuit of fire bottle is collected by voltage acquisition circuit of controller, and voltage data is directly displayed by display screen, direct detection of fire bottle trigger circuit is realized, without external voltmeter;Utilize supporting structure and test shell to form relatively simple structure, volume is smaller, and portability is higher, simultaneously, supporting structure can be supported according to the position of trigger circuit and the size of surrounding space State and the switching of storage state, further improve portability.

The application discloses application of a molecular marker related to a pig fattening period average daily feeding time trait, relates to the technical field of biology, and is characterized in that the application is any one of A1) to A4) below: A1) detecting or assisting in detecting a pig fattening period average daily feeding time; A2) identifying, assisting in identifying a pig fattening period average daily feeding time; A3) preparing a product for detecting or assisting in detecting a pig fattening period average daily feeding time; and A4) preparing a product for identifying, assisting in identifying a pig fattening period average daily feeding time. The application of the molecular marker related to the pig fattening period average daily feeding time trait discovers that a site of A / C at 270462812 of a chromosome 1 in a pig reference genome Sus_scrofa.Sscrofa11.1 has a significant influence on the pig fattening period average daily feeding time.

The invention provides an electrical parameter measuring device and method for a rock and soil sample. The device comprises a device base, a horizontal holder assembly, a pressure assembly, an AB power supply electrode assembly, a top end M and N spring electrode assembly, a lateral MN probe electrode assembly and an electrical parameter measuring module. Two horizontal clamp assemblies are symmetrically arranged on the left side and the right side of the device base, pressure assemblies are installed on the horizontal clamp assemblies and abut against the AB power supply electrode set, the top end M and N spring electrode assemblies are installed at the two ends of the middle of the device base and stretch across the device base, and the lateral MN probe electrode assembly is installed on the rear side of the device base. And the electrical parameter measuring module is connected with an electrode column on the device base. The technical problems that in a traditional method, clamping force is difficult to control, contact is poor, current distribution is uneven, the process is opaque, data cannot be post-processed and the like are solved, and universalization, high precision and repeatable measurement of rock and soil samples are achieved.

The utility model discloses a thyroid function detection assembly. The thyroid function detection assembly comprises a whole blood separation piece and at least one piece of detection test paper, the whole blood separation part is used for filtering red blood cells in blood; the detection test paper comprises a sample receiving end and a detection part, the whole blood separation part is connected with the sample receiving end, and the detection part is used for detecting the concentration of one of thyroid stimulating hormone, free triiodothyronine and free thyroxine. According to the thyroid function detection assembly, the thyroid function can be detected, during detection, the whole blood separation piece can rapidly separate red blood cells in blood within a short time, the rest of the separated blood can enter the detection test paper, detection can be completed by observing the detection part, the blood does not need to be centrifuged into serum, and the detection efficiency is improved. Direct detection of the whole blood sample can be realized, the detection cost is lower, the operation is simple and convenient, the detection time is greatly saved, and the detection efficiency is improved.

The invention discloses a fluorescent probe microplastic fluorescence detection method based on boron-fluorine dipyrrole, and relates to the technical field of fluorescence detection. The invention discloses a double-targeting ratio type fluorescent probe micro-plastic fluorescence detection method based on boron-fluorine dipyrrole, and relates to rhodamine spirolactam boron-fluorine dipyrrole organic fluorescent molecules as a fluorescent color developing agent combined with micro-plastics, and the fluorescent color developing agent can rapidly detect polyester and polystyrene micro-plastics in a water phase and an organic phase. The method is easy and convenient to operate, does not need complex pretreatment, has the advantages of being high in detection sensitivity, high in anti-interference performance and high in function integration degree, and is suitable for rapid detection and risk assessment of environment water samples and food contact material migration liquid.

This invention relates to a quantitative method for polyion-selective electrodes, specifically a novel method for rapid, accurate, and sensitive quantification based on the initial potential change rate of a polyion-selective electrode. Using an all-solid-state ultrathin polymer membrane polyion-selective electrode as the working electrode, it is inserted into the sample to be tested, causing the target polyions to accumulate at the membrane interface, generating an initial potential change rate. The concentration of polyions in the sample is then obtained based on the corresponding value of the initial potential change rate of the sample on a standard curve. This novel quantitative method for polyion-selective electrodes developed in this invention has advantages such as simple operation, short detection time, low operating cost, and suitability for on-site detection. It is of great significance for the direct potential determination of polyions and for counterion determination, enzyme assays, and immunoassays using polyion electrodes as signal converters.

The application discloses a method for detecting the concentration of formic acid in high-concentration sulfuric acid by high performance liquid chromatography, and belongs to the technical field of concentration detection. The method comprises the following steps: establishing a formic acid standard curve, filtering a sample through an acid-resistant filter membrane, directly injecting the sample, and detecting and calculating the formic acid content by using high performance liquid chromatography. The method is suitable for a 4-8 M sulfuric acid system, and can realize effective separation and accurate quantification of formic acid in a high-sulfate background. The method is simple in operation, and is suitable for rapid detection of formic acid in an industrial process and a complex reaction system.

The application discloses a nano antibody specifically recognizing staphylococcus aureus and a preparation method and application thereof. The ribosome display technology is adopted to screen a pair of nano antibody with good pairing effect through construction of a nano antibody display library, three rounds of high-throughput screening and ELISA verification, and the nano antibody is combined with an immunochromatography technology to be used for in-vivo detection of actual pathogenic bacteria. The nano antibody disclosed by the application shows high affinity and high specificity when being combined with the staphylococcus aureus, can realize a detection limit, and has the advantages of good stability and low cost compared with a monoclonal antibody, can be produced on a large scale, and has a wide application prospect in the field of staphylococcus aureus detection and analysis.

The application discloses a nucleic acid aptamer specifically recognizing alpha-amatoxin and screening and application thereof, and belongs to the technical field of biology. The application discloses nucleic acid sequences of alpha-amatoxin (alpha-AMA) specific aptamers, namely, SEQ ID NO. 1 to SEQ ID NO. 18, and constructs an electrochemical and colorimetric multi-signal detection alpha-amatoxin platform based on the aptamer Apt-14 with the lowest Kd of 6.128nM, modifies the aptamer on a gold-plated glassy carbon electrode, releases the complementary strand of the aptamer by using the specific binding of the aptamer and the target, triggers HCR amplification to perform signal amplification, and the detection limit is 5ng / mL, and the effect is good. The method is simple in operation, and the enzyme-free amplification mode is more conducive to on-site detection.

This invention discloses an online CO concentration detector and analyzer for use in the field of detection and analysis instruments. It comprises a main body, a pretreatment cylinder, and a modular filter assembly. The pretreatment cylinder contains a flow guide cover, a sleeve, and a filter element, achieving fluid diversion and filtration through a double-layer perforated group. The bottom vent cover is quickly removable, and the built-in filter box allows for flexible switching between air and liquid filter components, adapting to various forms of fluids, including gaseous and liquid states. The sampling component employs an electrically driven valve tube structure. This solution can detect CO concentration in a gaseous environment and can also achieve online monitoring of CO concentration in water by replacing the liquid filter assembly. It supports open environment detection and can also directly connect to an external test pipeline that has undergone pre-filtration to achieve direct detection of CO concentration within the pipeline. When the impurity content of the test liquid is low and continuous online monitoring of large-flow water is required, the replacement and maintenance steps of the filter assembly can be omitted, and detection can be completed directly.

The invention discloses a sensor based on a phage display nano antibody and application of the sensor. The amino acid sequence of the phage display nano antibody is EVQLVESGGLVQAGGSLRLSCATSG RTFSTFSTYVAGWFRQAPGKEREFVAAAIRRTGGRTYYADSVKGRFTISGDNAKNMVYLQMNSLKPEDTATYYCAAANNLGSDYVTVTGKYDYWGQGTQVIVSS, and the amino acid sequence of the phage display nano antibody is shown in the specification. According to the invention, the staphylococcus aureus-targeted specific bacteriophage display nano-antibody is screened as a high-performance probe, and is paired with an Fc fragment to construct a high-quality recognition element, so that the defects of instability and accuracy of a traditional probe are overcome. Staphylococcus aureus can be qualitatively detected within one minute, and the method has high sensitivity and excellent specificity and accuracy.