Chimeric polypeptide with dual-targeting function and applications thereof
A chimeric polypeptide and dual-targeting technology, which is applied in the preparation of protein-based polypeptides and its application field, to achieve the effects of increasing expression, strong pertinence, and reducing the number of medication
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0029] 1. Preparation of chimeric polypeptide of the present invention
[0030] according to figure 1 According to the arrangement design, a chimeric peptide sequence composed of 80 amino acids at the N-terminal of lysozyme, 2 amino acid linking sequences and Exendin-4 was generated by genetic engineering technology, the sequence is as follows:
[0031] MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNT
[0032] RATNYNAGDRSTDYGIFQINSRGPHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 3)
[0033] The underline is the connection sequence, and P in the connection sequence can also be A, S, V, L.
[0034] The specific steps for preparing the above sequence are as follows:
[0035] 1. Obtain the DNA sequence of 80 amino acids at the N-terminal of human lysozyme and the cleavage sites of thrombin and dipeptidase by using PCR method or chemical synthesis method;
[0036] 2. Obtain the linking sequence containing thrombin and dipeptidase cleavage site and the DNA sequen...
Embodiment 2
[0048] according to figure 1 According to the arrangement design, a chimeric polypeptide consisting of 60 amino acids at the N-terminal of lysozyme, 6 amino acid linking sequences and Exendin-4 was synthesized by chemical synthesis, and then purified and prepared according to conventional methods. Peptide pharmaceutical ingredients.
[0049] The sequence of the chimeric polypeptide in this example is:
[0050] MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNT
[0051] RALVPRGPHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 4)
[0052] The underline is the connection sequence, L and V in the connection sequence can also be A, I, M, F, P, W, etc., and the P in the last position of G in the connection sequence can also be A, S, V, L.
Embodiment 3
[0054] according to figure 1 According to the arrangement design, a chimeric polypeptide composed of 40 amino acids at the N-terminal of lysozyme, 12 amino acid linking sequences, and Exendin-4 was synthesized by chemical synthesis, and then purified and prepared according to conventional methods for this chimeric polypeptide drug suitable for human Element.
[0055] The sequence of the chimeric polypeptide in this example is:
[0056] MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGLVPRGPLVPRGPHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 5)
[0057] The underline is the connection sequence, L and V in the connection sequence can also be A, I, M, F, P, W, etc., and the P in the last position of G in the connection sequence can also be A, S, V, L.
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com
