Site-specific mutagenesis high temperature resistant phytase gene TP and expression vector and application thereof

A high-temperature-resistant phytase and site-directed mutation technology, which can be used in plant gene improvement, application, genetic engineering, etc., can solve the problem of phytase enzyme activity damage, phytase heat-resistant effect is not ideal, and thermal stability is not very good Solve problems such as well to achieve the effect of improving thermal stability, considerable economic and social benefits, and good heat resistance

A high-temperature-resistant phytase and site-directed mutation technology, which can be used in plant gene improvement, application, genetic engineering, etc., can solve the problem of phytase enzyme activity damage, phytase heat-resistant effect is not ideal, and thermal stability is not very good Solve problems such as well to achieve the effect of improving thermal stability, considerable economic and social benefits, and good heat resistance

CN102943083AActive Publication Date: 2013-02-27TIANJIN CHIATAI FEED TECH

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Site-specific mutagenesis high temperature resistant phytase gene TP and expression vector and application thereof
  • Site-specific mutagenesis high temperature resistant phytase gene TP and expression vector and application thereof
  • Site-specific mutagenesis high temperature resistant phytase gene TP and expression vector and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0018] 1. Acquisition of Escherichia coli phytase (appA phytase) protein mutant gene

[0019] 1. Select the phytase gene sequence in Escherichia coli strain Escherichia coli str.K-12 as shown in SEQ ID No: 2, the appA phytase amino acid sequence as shown in SEQ ID No: 1, the active site of phytase The point conserved sequence is RHGXRXP.

[0020] Phytase amino acid sequence (SEQ ID No: 1) in NCBI:

[0021] QSEPELKLESVVIVSRHGVRAPTKATQLMQDVTPDAWPTWPVKLGWLTPRGGELIAYLG

[0022] HYQRQRLVADGLLAKKGCPQSGQVAIIADVDERTRKTGEAFAAGLAPDCAITVHTQADTS

[0023] SPDPLFNPLKTGVCQLDNANVTDAILSRAGGSIADFTGHRQTAFRELERVLNFPQSNLCLK

[0024] REKQDESCSLTQALPSELKVSADNVSLTGAVSLASMITEIFLLQQAQGMPEPGWGRITDSH

[0025] QWNTLLSLHNAQFYLLQRTPEVARSRATPLLDLIKTALTPHPPQKQAYGVTLPTSVLFIAGH

[0026] DTNLANLGGALELNWTLPGQPDNTPPGGELVFERWRRLSDNSQWIQVSLVFQTLQQMRD

[0027] KTPLSLNTPPGEVKLTLAGCEERNAQGMCSLAGFTQIVNEARIPACSL

[0028] Phytase base sequence in NCBI (SEQ ID No: 2):

[0029] CAGAGTGAGCCGGAGCTGAAGCTGGAAAGTGTGGTGAT...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
survival rateaaaaaaaaaa
Login to View More

Abstract

The invention provides site-specific mutagenesis high temperature resistant phytase gene TP and an expression vector and application thereof. Amino acid in a specific area in a phytase amino acid sequence is mutated into praline and arginine so as to enable the phytase to have a special stable protein structure. Simultaneously, a gene sequence is optimized to synthesize a phytase gene according to pichia pastoris codon preference and GC content, recombinant plasmids are built and transferred to pichia pastoris, and positive converters are obtained through screening to conduct induction expression to obtain the high temperature resistant phytase. Experiments prove that the phytase obtained through expression of the pichia pastoris can resist high temperature plasmids with the temperature higher than 85 DEG C, and survival rate reaches 85%. Popularization and application of the high temperature resistant phytase have substantial economical benefit and social benefit on development of feed animal husbandry of our country, and simultaneously great ecological benefit can be obtained.

Description

technical field [0001] The invention belongs to the field of molecular biology feed additives, and in particular relates to a site-directed mutation high-temperature-resistant phytase gene TP, an expression carrier and application thereof. Background technique [0002] Phytic acid (phytic acid) is the main storage form of phosphorus in plants, and phytic acid and its salts are the main storage form of phosphorus in crops such as grains, beans, and oilseeds. Due to the lack of corresponding enzymes in the stomach of monogastric animals, phytic acid cannot be hydrolyzed and utilized, which causes a waste of phosphorus sources, and the phosphorus in the unusable phytic acid is directly excreted, resulting in phosphorus pollution of soil and water. In addition, phytic acid can also chelate with mineral elements and protein, so that these nutrients cannot be effectively used, resulting in a reduction in the nutritional value of plant feed. Therefore, phytic acid is also generally...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
27 Feb 2013
Publication
CN102943083A
IPC
C12N15/55; C12N9/16; C12N15/81; A23K1/165
Inventors
张大伟; 王希辉