Double sandwich immunoassay test kit labeled by HE4 quantum dots and application thereof
A detection kit and immunoassay technology, applied in the field of immunodiagnosis, can solve the problems of low sensitivity and poor specificity, and achieve the effects of stable fluorescence, weak autofluorescence and long half-life
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0018] Example 1: HE4 prokaryotic expression vector construction and protein expression, purification and identification
[0019] 1. Selection of HE4 immunogen
[0020] (1) HE4 gene immunogenic region
[0021] GAGAAGACTGGCGTGTGCCCCGAGCTCCAGGCTGACCAGAACTGCACGCAAGAGTGCGTCTCGGACAGCGAATGCGCCGACAACCTCAAGTGCTGCAGCGCGGGCTGTGCCACCTTCTGCTCTCTGCCCAATGATAAGGAGGGTTCCTGCCCCCAGGTGAACATTAACTTTCCCCAGCTCGGCCTCTGTCGGGACCAGTGCCAGGTGGACAGCCAGTGTCCTGGCCAGATGAAATGCTGCCGCAATGGCTGTGGGAAGGTGTCCTGTGTCACTCCCAATTTC
[0022] (2) Translation of the immunogenic region
[0023] EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMK CCRNGCGKVSCVTP
[0024] 2. Construction of HE4 prokaryotic expression vector
[0025] (1) Restriction site and primer sequence
[0026] EcoRI Up primer: CCG gaattc gagaagactggcgtgtgcccc
[0027] XhoI Down primer: CCG ctcgag gaaattgggagtgacacagga
[0028] (2) Construction of HE4 prokaryotic expression vector
[0029] Mucinous ovarian cancer cells were...
Embodiment 2
[0037] Example 2: Preparation and identification of rabbit anti-human HE4 polyclonal antibody
[0038] 1. Animal immunity
[0039]Prepare two adult rabbits, dissolve 100μg antigen / rabbit into 1ml phosphate buffer solution for use. Add mycobacteria to 1ml of Freund's incomplete adjuvant to make a complete adjuvant, add 1ml of antigen solution, shake vigorously to make it fully emulsified, draw out the emulsion with a 3ml syringe, connect it with a 25G needle, and remove the air bubbles in the syringe . Rabbits were removed from the cage and placed on a flat surface, and subcutaneous injections were administered at 4 different sites, two on the back and two on the thigh. Brush the rabbit fur from the injection site and disinfect the exposed skin with ethanol. Pinch out the skin, insert the needle at an angle of 15 degrees relative to the skin, the depth of the needle is 1cm-2cm, be careful not to pierce the muscle, and inject about 500 μl of antigen solution in each of the 4 ...
Embodiment 3
[0062] Example 3: Preparation and identification of mouse anti-human HE4 monoclonal antibody
[0063] 1. Preparation of mouse anti-human HE4 monoclonal antibody
[0064] (1) Animal immunity
[0065] Immunization scheme: Fully emulsify the purified recombinant human HE4 antigen with an equal volume of Freund's complete adjuvant to make a water-in-oil antigen emulsion. SPF-grade pure-line BALB / c female mice aged 6-8 weeks, subcutaneously in multiple spots on the back injection. 100μg / rat, after two weeks, emulsify and immunize with the same amount of antigen plus the same volume of Freund's incomplete adjuvant. Booster immunizations were carried out at the end of the 2nd, 4th, and 6th weeks after the first immunization, and the same dose of the target protein was used each time. The titer of serum antibody was detected by indirect ELISA method. 3 days before cell fusion, mice were injected with 100 μg HE4 protein through tail vein or intraperitoneally to boost immunization. ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


