Unlock instant, AI-driven research and patent intelligence for your innovation.

A kind of monoclonal antibody fnab12 and its application

An antibody and carrier technology, applied in the field of biomedicine, can solve problems such as difficult to obtain protein molecules

Active Publication Date: 2021-03-16
SHANGHAI JIAO TONG UNIV
View PDF3 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, there are many factors affecting this effect, and it is difficult to obtain protein molecules with suitable properties in this field

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of monoclonal antibody fnab12 and its application
  • A kind of monoclonal antibody fnab12 and its application
  • A kind of monoclonal antibody fnab12 and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0162] Example 1 Screening and Preparation of Monoclonal Antibodies

[0163] In this example, the constructed single-chain antibody phage library is screened, and the specific screening method is as follows: figure 1 As shown, that is, b2M and hFcRn&b2M are biotin-labeled first, then the biotin-labeled b2M is mixed with the phage antibody library for subtractive screening, and the phage bound to b2M is removed by magnetic beads coupled with avidin protein Finally, the supernatant was mixed with biotin-labeled hFcRn&b2M protein, and the phages bound to hFcRn were collected with magnetic beads. After amplification, the next round of panning was performed. After three consecutive rounds of panning, a single phage was picked and amplified. Apply phage enzyme-linked immunosorbent assay method to identify positive phages, then sequence them, clone the gene into a new expression vector, express and purify the antibody, and conduct subsequent identification of binding and affinity.

...

Embodiment 2

[0169] Preparation of embodiment 2 fusion protein

[0170] The nucleotide sequence expressing GLP1 (7-36 amino acids, containing A8G, G22E, and R36G three mutation sites) is connected to the 5' end of the nucleotide sequence of FnAb8 or FnAb12 with a (G4S)3 linker sequence, and the gene After the sequence was synthesized, it was inserted into the expression vector pcDNA3.1 (GenScript Biotechnology Co., Ltd.), and then the plasmid was transfected into mammalian cells to prepare the protein.

[0171] The amino acid sequence of the GLP1 (AA7-36) protein used in this example is as follows:

[0172] HGEGFTTSDVSSYLEEQAAKEFIAWLVKGG (SEQ ID NO.: 2)

[0173] In this example, GLP1 (AA7-36) was successfully fused and expressed with two strains of single-chain antibodies, and a fusion protein was prepared. The fusion protein produced by fusion expression with FnAb8 was named G8, and the fusion protein produced by fusion expression with FnAb12 Named G12.

[0174] The amino acid sequence...

Embodiment 3

[0178] In vitro activity detection of embodiment 3 fusion protein

[0179] The combination of GLP-1 fusion protein and its corresponding receptor protein was identified by plasmon surface resonance (SPR). GLP-1R-Fc protein and hIgG were immobilized on the CM5 chip by chemical coupling using Biacore T100. 200nM FnAb8, G8, FnAb12 and G12 respectively flowed over the surface of the chip at high speed, and their binding signals were detected.

[0180] Biacore was used to identify the binding of GLP-1 fusion protein to hFcRn. hFcRn was coupled to a CM5 chip, and 200nM FnAb8, G8, FnAb12 and G12 were flowed over the surface of the chip at high speed to detect the binding signal.

[0181] The experimental results in this example prove that G8 and G12 can specifically bind to GLP-1R. And both G8 and G12 can bind to FcRn protein, and maintain the pH dependence of the binding. image 3 Binding of G12 to GLP-1R-Fc protein is shown. GLP-1R-Fc or hIgG was coupled to the CM5 chip, and 200...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
affinityaaaaaaaaaa
Login to View More

Abstract

The invention provides a monoclonal antibody FnAb12 and an application thereof. An experimental result proves that the sequence acquired according to the invention is coupled with protein, polypeptides or other pharmaceutical molecules and the FcRn circular protecting mechanism can be utilized to greatly prolong the half-life period and promote the curative effect of the drug.

Description

technical field [0001] The invention belongs to the field of biomedicine, in particular, the invention relates to a monoclonal antibody FnAb12 and its application. Background technique [0002] FcRn (neonatal Fc receptor, neonatal Fc receptor) is a structural analog of the major histocompatibility complex class I molecule (MHC-I), which is composed of two polypeptide chains non-covalently coupled to form a heterologous two One is the type I transmembrane protein α chain, which is composed of three extracellular domains α1, α2, and α3, the transmembrane region and the intracellular segment, and the other is the β2-microglobulin chain (β2M). [0003] The main function of FcRn is to bind the Fc segment of IgG molecules and serum albumin (SA), preventing its endocytosis and entering into the cell's protein degradation pathway, thereby prolonging their lifespan in vivo. Immunoglobulin (IgG) and albumin (Serumalbumin, SA) are the two most abundant protein molecules in the human b...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K16/28C07K19/00C12N15/13C12N15/62A61K47/68G01N33/68
CPCC07K14/605C07K16/2833C07K2317/565C07K2319/00G01N33/68G01N2333/70535
Inventor 徐宇虹邱阳生
Owner SHANGHAI JIAO TONG UNIV