Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Growth regulator for fruiting period of peanuts

A growth regulator and pod stage technology, applied in the field of peanut pod stage growth regulator, to achieve the effects of promoting accumulation, improving enzyme activity, and convenient operation

Inactive Publication Date: 2017-11-21
磐安县派普特生物科技有限公司
View PDF4 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0006] In order to solve the above problems of special growth regulation for peanut pod setting, the present invention provides a special growth regulator for peanut pod setting that can not only control the vigorous growth of plants, but also delay aging and increase yield.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0019] A growth regulator for peanut pod stage, the growth regulator is composed of the following components and their percentages: 30% growth promoter, 70% growth nutrient solution.

[0020] The growth promoter consists of the following components and parts by weight: 7 parts of chitosan oligosaccharide, 11 parts of glucan oligosaccharide, 0.2 part of sulforaphane, 5 parts of potassium fertilizer, 1 part of cyclodextrin, 0.1 part of active polypeptide, 5 parts of - 12 parts of aminolevulinic acid and 2 parts of trace elements, this growth promoter can effectively promote the growth of peanut pods, increase the speed of pods, reduce the absorption of toxins, promote the photosynthesis of plants, and accelerate the growth of plants. And make the fruit more plump, and it can also prevent the peanuts from growing into deformities.

[0021] The amino acid sequence of the active polypeptide is TDHQMAQHSHACKLFCCGAAKCYLCRVCVCVNCSKQDNAYASAIPRDCHGGKTICADATATRYSDTGGPLSTARCVNAFHFYKRRGEEN...

Embodiment 2

[0028] A growth regulator for peanut pod stage, the growth regulator is composed of the following components and their percentages: growth promoter 35%, growth nutrient solution 65%.

[0029] The growth promoter consists of the following components and their parts by weight: 16 parts of chitosan oligosaccharide, 21 parts of glucan oligosaccharide, 0.4 part of sulforaphane, 5-13 parts of potassium fertilizer, 3 parts of cyclodextrin, and 0.2 part of active polypeptide , 18 parts of 5-aminolevulinic acid, and 4 parts of trace elements. This growth promoter can effectively promote the growth of peanut pods, increase the speed of pods, reduce the absorption of toxins, promote photosynthesis of plants, and accelerate the growth of plants. Growth, and make the fruit more plump, but also prevent peanuts from growing into deformities.

[0030] The amino acid sequence of the active polypeptide is TDHQMAQHSHACKLFCCGAAKCYLCRVCVCVNCSKQDNAYASAIPRDCHGGKTICADATATRYSDTGGPLSTARCVNAFHFYKRRGEENV...

Embodiment 3

[0037] A growth regulator for peanut pod stage, the growth regulator is composed of the following components and their percentages: growth promoter 33%, growth nutrient solution 67%.

[0038] The growth promoter consists of the following components and their parts by weight: 7-16 parts of chitosan oligosaccharide, 17 parts of glucan oligosaccharide, 0.3 part of sulforaphane, 10 parts of potassium fertilizer, 2 parts of cyclodextrin, and 0.3 part of active polypeptide , 15 parts of 5-aminolevulinic acid and 3 parts of trace elements. This growth promoter can effectively promote the growth of peanut pods, increase the speed of pods, reduce the absorption of toxins, promote photosynthesis of plants, and accelerate the growth of plants. Growth, and make the fruit more plump, but also prevent peanuts from growing into deformities.

[0039] The amino acid sequence of the active polypeptide is TDHQMAQHSHACKLFCCGAAKCYLCRVCVCVNCSKQDNAYASAIPRDCHGGKTICADATATRYSDTGGPLSTARCVNAFHFYKRRGEENVS...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a growth regulator for the fruiting period of peanuts. The growth regulator comprises the following components in percentage: 30-35% of growth promoter and 65-70% of growth nutrient solution. The regulator can favorably remove oxygen free radicals and delay senility; and the regulator obviously improves the activity of leaf nitrate reductase and the activities of glutamine synthetase and glutamate synthetase, and improves the activities of leaf sucrose synthetase and sucrose phosphate synthetase, thereby being beneficial to the accumulation of dry matters in pods and the synthesis of protein and fat in seed kernels. The growth regulator obviously increases the yield of peanut pods; and the yield is increased because the weight of a single pod is obviously increased, the full-pod rate is improved, and the dual-kernel pod rate and the kernel rate are greatly improved.

Description

technical field [0001] The invention relates to the technical field of peanut cultivation, in particular to a growth regulator for peanut pod setting. Background technique [0002] In the main peanut producing areas, peanut production is often threatened by excessive growth or even lodging, which seriously affects the yield and quality of peanuts. At present, the production mainly relies on spraying plant growth regulators to control the excessive growth of peanuts during the peak growth period. As a high-efficiency, low-toxic plant growth retardant and broad-spectrum fungicide, paclobutrazol has become an important chemical control measure in agricultural production. However, spraying paclobutrazol can easily lead to premature aging of peanuts in the later stage of growth, and will also affect the further improvement of yield and quality. Therefore, it is urgent to invent a novel foliar growth regulator for peanut pods, which can not only control excessive growth but also ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C05G3/00
CPCC05C11/00C05G3/00C05D1/00C05D9/00C05D9/02C05F11/00C05F11/10
Inventor 施春华
Owner 磐安县派普特生物科技有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com