Novel human antimicrobial peptide LL-37 derivative and application thereof
A human antimicrobial peptide, LL-37 technology, applied in the field of molecular biology, can solve the problems of inability to realize large-scale production, complex process, expensive cost, etc., to solve the problem of antibiotic abuse, good antibacterial effect, and stability improvement Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0015] Embodiment 1 of the present invention is: a novel human antimicrobial peptide LL-37 derivative, the amino acid sequence of which is Leu-Leu-Asp-Phe-Lys-Glu-Arg-Lys-Glu-Lys-Gln-Phe-Lys -Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Gln-Asn, molecular weight 3177.6D. As shown in Table 1, the novel human antimicrobial peptide LL-37 derivatives include the antibacterial activity structure of the antimicrobial peptide LL-37 Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe- Leu-Arg.
[0016] Peptide name
amino acid sequence
Antimicrobial peptide LL-37
[LL-37, 37 aa]
Antimicrobial Peptide LL-37 Derivatives
LLDFKERKEKQFKRIVQRIKDFLRQN
[0017] The antimicrobial peptide LL-37 derivative modified by the scheme of the present invention is rich in glutamine and cysteine, which enhances the stability of the antimicrobial peptide. Adding asparagine and lysine can attract negative charges on the surface of bacteria and enhance an...
Embodiment 2
[0019] Example 2 of the present invention is: preparation of a novel human antimicrobial peptide LL-37 derivative sodium chloride injection: this embodiment is the preparation of antibacterial drugs for the novel human LL-37 antimicrobial peptide derivative of the present invention The amino acid sequence of the antimicrobial peptide derivative is Leu-Leu-Asp-Phe-Lys-Glu-Arg-Lys-Glu-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile -Lys-Asp-Phe-Leu-Arg-Gln-Asn with a molecular weight of 3177.6D. This antimicrobial peptide derivative is made into polypeptide bacteriocin sodium chloride injection, and every 100ml injection is made up of following components: main agent is the antimicrobial peptide 0.5g of SEQ ID NO:1 sequence, and its percentage is 0.5%, chlorination Sodium 0.9g, the balance is water for injection.
[0020] Weigh the water for injection of 60% of the total volume of the prescribed amount, then add the prescribed amount of SEQ ID NO: 1 sequence antimicrobial peptide deriv...
Embodiment 3
[0021] The third embodiment of the present invention is: the preparation of a novel human-derived antimicrobial peptide LL-37 derivative gel: this embodiment is the application of the novel human-derived LL-37 antimicrobial peptide derivative in the preparation of antibacterial drugs. The amino acid sequence of the antimicrobial peptide derivative is Leu-Leu-Asp-Phe-Lys-Glu-Arg-Lys-Glu-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp- Phe-Leu-Arg-Gln-Asn, the molecular weight is 3177.6D. The antimicrobial peptide derivative is made into a polypeptide gel, and every 1000g of the gel is composed of the following components: the antimicrobial peptide 10g of the main drug SEQ ID NO:1 sequence, the auxiliary material Carbomer-940 10g, lauryl azepine Ketone 50ml, glycerin 200ml, Span-85 50ml, triethanolamine 20ml, and the balance is water for injection.
[0022] Weigh 10 g of the excipient Carbomer-940 powder, add an appropriate amount of water for injection and mix well, then add 5...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap