Supercharge Your Innovation With Domain-Expert AI Agents!

Antifungal peptide as well as preparation method and application thereof

An antifungal peptide and antifungal technology, applied in the fields of biochemistry and biomedicine, can solve the problems of the size, composition charge and secondary structure of antimicrobial peptides, achieve low cytotoxicity, broad antifungal spectrum, overcome specific activity degree of effect

Active Publication Date: 2012-07-25
INST OF ZOOLOGY CHINESE ACAD OF SCI
View PDF1 Cites 5 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

At present, scientists have obtained hundreds of natural and synthetic antimicrobial peptides, but these antimicrobial peptides are very different in size, composition, charge and secondary structure.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antifungal peptide as well as preparation method and application thereof
  • Antifungal peptide as well as preparation method and application thereof
  • Antifungal peptide as well as preparation method and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0038] Example 1 Extraction and purification of AP polypeptide

[0039] Naturally grown bladder snails were captured from the wild and raised in the laboratory at a temperature of 15°C and a salinity of 35‰.

[0040] Collect 0.5ml of blood from each bladder snail, and add an equal volume of modified Alsever’s solution anticoagulant buffer (the buffer formula is as follows: trisodium citrate 2H 2 O 8.0g, citric acid 0.5g, anhydrous glucose 20.8g, sodium chloride 22.3g, EDTA 3.36g, distilled water 1000ml, dissolve, filter, sub-package, autoclave, 4 ℃ refrigerator for later use) mix well, put in 800g , centrifuged at 4°C for 15min; the blood cell pellet was frozen and thawed three times, then added 5 times the volume of 50mM Tris buffer (pH8.7, containing 50mM NaCl), and then homogenized with a glass homogenizer; at 10000g, 4°C Centrifuge at low temperature for 20 minutes; resuspend the pellet containing organelles with 3 times the volume of 2M acetic acid, place in a cold wat...

Embodiment 2

[0045] Example 2 Design of New Antimicrobial Peptide Apn

[0046] In order to improve the hydrophobicity (from 25% to 38%) and cationic surface activity (from +1 to +5) of the antimicrobial peptide, 10 hydrophilic amino acids were deleted from the N-terminus: T-1, Y-2 , Y-10, N-13, S-15, Y-16, Q-19, N-23, Q-31 and Y-44. Simultaneous deletion of five negatively charged amino acids: E-6, E-7, E-9, D-18 and D-37. The formed amphiphilic polypeptide is named Apn, which is a polypeptide different from AP, and its sequence is as follows: MPVGIVIAPKKSPFTAKKPPGVLSGVKAPGG (SEQ.ID.NO.2).

Embodiment 3

[0047] Example 3 Chemical Synthesis and Purification of Antimicrobial Peptides

[0048] The above polypeptides Ap and Apn were synthesized by standard chemical synthesis method (Lu Yingjin, Wang He. Solid-phase synthesis of antimicrobial peptides, separation and purification and study on structure-activity relationship, Acta Biological Engineering, 1997, 13(1):35-41).

[0049] After synthesis, the polypeptide was extracted with double-distilled water with 10% (v / v) acetic acid, and then purified by RP-HPLC with a purity greater than 95%. The molecular weight of the purified polypeptide Apn was determined to be 3.028kDa by mass spectrometry.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
Molecular weightaaaaaaaaaa
Login to View More

Abstract

The invention provides an antifungal peptide as well as a preparation method and application thereof. The antifungal peptide is the peptide with amino acid sequences shown in SEQ ID NO.2, or a biological activity function fragment, variant or derivative of the peptide. The antifungal peptide has the advantages of relatively wide antifungal spectrum and low cytotoxicity. The antifungal peptide is prepared by a biological or chemical method, can be used for overcoming the defects of low specific activity or the like during the natural polypeptide scale production and application, can be appliedin the aquaculture industry, especially in controlling the water fungus and can be used for effectively protecting each stage of the fish growth.

Description

technical field [0001] The invention relates to an antifungal peptide with antifungal activity, its preparation method and application, and belongs to the fields of biochemistry and biomedicine. Background technique [0002] Antimicrobial peptides are a class of amphipathic small-molecule basic polypeptides that widely exist in the entire biological world. They are widely present in organisms, including bacteria, fungi, plants, insects, fish, birds, crustaceans, amphibians and mammals. etc., there are more than 750 species, most of which are cationic antimicrobial peptides, and there are also a small amount of anionic antimicrobial peptides. Because antimicrobial peptides exhibit broad-spectrum antimicrobial activity and have a neutralizing effect on bacterial toxins, their unique mechanism of action is not easy to produce drug resistance, and some antimicrobial peptides only work on prokaryotes and mutant cells, but not on eukaryotes. The creature is harmless. Therefore, ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/435C07K1/14A61K38/17A61P31/10
Inventor 何宏轩王承民罗静董国英郭云海
Owner INST OF ZOOLOGY CHINESE ACAD OF SCI
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com