Method for extracting low-molecular-weight kelp fucoidin

A kelp fucoidum, low molecular weight technology, applied in the field of polysaccharide extraction, to achieve the effects of high polysaccharide yield, high antitumor activity and good solubility

Inactive Publication Date: 2018-02-02
兰溪市沉默生物科技有限公司
View PDF5 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In this invention, fucoidan is recovered from waste water by using green and environment-friendly ionic liquid. The amount of ionic liquid is small and can be reused. The amount of ethanol used in the recovery process is very small, which avoids the use of a large amount of ethanol in the prior art. The disadvantage of precipitating fucoidan, thus reducing the production cost, but the polysaccharide yield of this method still has room for further improvement

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0015] A method for extracting low-molecular-weight kelp fucoidan includes cell wall breaking; crude polysaccharide extraction; polysaccharide extraction, separation and purification. The specific operation steps are as follows:

[0016] Cell wall breakage: Take 12 parts of fucoid powder and soak in absolute ethanol for defatting. The solid residue is extracted with water and the ratio of material to liquid is 1:11m / V. Stir for 27min, and let it stand for 4.5h in a sealed state. Add active peptide. The amount of active peptide is fucoid powder 0.05% of the weight, the amino acid sequence of the active peptide is: HSHACASYYCSKFCGSCTHYLCRVLHPGKNCSR, stirring for 6min, steam explosion treatment, pressure 2.4MPa, maintaining 35s, to obtain cell crushing liquid; during the steam explosion process, the vapor infiltration in the cell wall is limited, which will cause The degree of wall breakage is not high. By adding active peptides, the active peptides act on the surface of the kelp fuc...

Embodiment 2

[0021] A method for extracting low-molecular-weight kelp fucoidan includes cell wall breaking; crude polysaccharide extraction; polysaccharide extraction and separation and purification. The specific preferred operation steps are as follows:

[0022] Cell wall breakage: Take 15 parts of fucoid powder and soak in absolute ethanol for defatting. The solid residue is extracted with water and the material-liquid ratio is 1:14m / V. Stir for 28min, and let it stand in a sealed state for 5h. Add active polypeptide. The amount of active polypeptide is the weight of fucoid powder. The amino acid sequence of the active peptide is: HSHACASYYCSKFCGSCTHYLCRVLHPGKNCSR, stirring for 6min, steam explosion treatment, pressure 2.5MPa, maintaining 35s, to obtain cell crushing liquid; during the steam explosion process, the vapor infiltration in the voids of the cell wall is limited, which will cause destruction The wall degree is not high. By adding active peptides, the active peptides act on the sur...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention discloses a method for extracting low-molecular-weight kelp fucoidin, and belongs to the technical field of extraction of polysaccharide. The method for extracting the kelp fucoidin comprises the following steps: cell wall cracking, polysaccharide rough extraction, and polysaccharide extraction, separation and purification. The step of cell wall cracking is as follows: taking 10-16 parts by weight of fucus powder, soaking the fucus powder with anhydrous ethanol for degreasing, extracting solid residues with water under the condition that the solid-liquid ratio is 1: 10-15 m/V, stirring for 20-35 min, standing for 4-6 h in a sealed manner, adding active peptide, stirring for 5-8 min, carrying out steam blasting treatment, and maintaining pressure at 2-2.8 MPa for 30-40 S to obtain cell breakage liquid. The breakage rate of the kelp fucoidin is increased by the active peptide, the yield and purity of the fucoidin are improved, the extracted fucoidin is low in molecular weight, easy to absorb and good in anti-tumor and health-care effect, and the preparation cost of the fucoidin is low.

Description

Technical field [0001] The invention belongs to the technical field of polysaccharide extraction, and specifically relates to a method for extracting low molecular weight kelp fucoidan. Background technique [0002] my country is a major producer of kelp, and after decades of development, it has become the world's largest producer of kelp. According to statistics, China's seaweed production reached 1 million tons in 2009, of which kelp production accounted for more than 70% of the world's total production. It has become one of the important pillar industries of my country's marine economy, with huge social and economic benefits. Kelp is a nutrient-rich edible brown algae. Every 100g of kelp contains nutrients: 8.2g protein, 56.2g carbohydrate, 117mg calcium, 150mg iron, 25mg iodine, and also contains carotene, thiamine, riboflavin, Vitamins such as niacin. It is rich in nutrients, especially low-calorie, medium-protein, and high-mineral. It has edible functions such as helping...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C08B37/00
CPCC08B37/0003
Inventor 周建波
Owner 兰溪市沉默生物科技有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products