Azo red dye decolorized enzyme and preparation method and application thereof
A dye decolorization and azo red technology, which is applied in the field of artificial metalloenzymes, can solve the problems of poor catalytic effect of Amaranth, and achieve the effects of improving catalytic efficiency, reducing dependence and mild reaction conditions
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0039] Based on genetic engineering and protein engineering, using site-directed mutagenesis, tyrosine was introduced at position 43, tryptophan at position 138, and arginine at position 67 near the active center of myoglobin heme, and then in Escherichia coli BL21(DE3) Expressed in , and separated by ion exchange column (DEAE 52 resin) and gel column (Superdex 75) to separate and purify the protein to obtain the F43Y / F138W / T67R Mb mutant protein.
[0040] The amino acid sequence (SEQ ID NO.1) of the F43Y / F138W / T67R Mb mutant is as follows:
[0041] VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKYDRFKHLKTEAEMKASEDLKKHGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELWRKDIAAKYKELGYQG.
Embodiment 2
[0043] 10 μM F43Y / F138W / T67R Mb was prepared in 100 mM phosphate buffer (pH 7.0). Meanwhile, prepare 6 mM H with deionized water 2 o 2 and 100mM amaranth (Amaranth) mother solution, the concentration is demarcated with ultraviolet spectrum (H 2 o 2 for ε 240nm =39.4M - 1 cm -1 , Amaranth is ε 521nm =13.6mM -1 cm -1 ).
[0044] Take 2 mL of the above F43Y / F138W / T67R Mb solution, add 2.4 μL of 100 mM Amaranth mother solution, mix evenly and place it in the C sampler of the rapid dwell spectrometer, and take 6 mM H 2 o 2 2mL was placed in the D injector. The catalytic reaction was carried out after sample injection and mixing by C and D injectors, the reaction time was 100s, and a total of 500 spectra were collected ( figure 1 ). Monitor the change of Amaranth characteristic absorption 521nm absorption peak with time ( figure 2 ).
[0045] The results showed that F43Y / F138W / T67R Mb could make the absorption peak of the dye Amaranth at 521nm almost disappear with...
Embodiment 3
[0047] 5 μM F43Y / F138W / T67R Mb was prepared in 100 mM phosphate buffer (pH 7.0). Meanwhile, prepare 200 mM H with deionized water 2 o 2 and 100mM amaranth mother solution (Amaranth), the concentration was demarcated by ultraviolet spectrum (H 2 o 2 for ε 240nm =39.4M - 1 cm -1 , Amaranth is ε 521nm =13.6mM -1 cm -1 ).
[0048] Take two cuvettes of the same specification (clean and dry), add 2 mL of the above F43Y / F138W / T67R Mb solution to each, and add 1.2 μL of 100 mM Amaranth mother solution and mix well. Then add 30 μL 200mM H to the cuvette 2 o 2 , the operation requires simultaneous execution. React for 100s and take pictures. The color of the solution before and after the reaction is as follows: image 3 .
[0049] The results show that F43Y / F138W / T67R Mb can completely decolorize the dye Amaranth in about 100s (note: the color of the solution after the reaction is the color of F43Y / F138W / T67R Mb protein, not the color of the dye).
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



