A kind of preparation method of insulin glargine and its analogues
A technology for insulin analogues and insulin glargine, which is applied in the field of preparation of insulin glargine and its analogues, can solve the problems of low yield, low separation yield, high cost, etc., achieve high yield, wide application range, and method easy effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0051] Embodiment 1: Utilize Escherichia coli expression system to construct genetically engineered bacteria
[0052] The preferred codons of Escherichia coli were selected, and the gene fragment expressing the precursor of insulin glargine was obtained by fusion PCR technology. The amino acid sequence translated was FVNQHLCGSHLVEALYLVCGERGFFYTPKTRRKEAEDLQVGQVELGGGPGAGSLQPLALEGSLQRKGIVEQCCTSICSLYQLENYCG. GSK connection, the fusion sequence selected in this embodiment is a segment of staphylococcal protein A (SPA), MADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNK. After introducing the NdeIEcoRI enzyme cutting site and connecting it into the expression vector pET17b, the genetically engineered bacteria expressing the precursor of insulin glargine were obtained after conventional genetic engineering. figure 2 , with figure 2 The target protein band in the expression is the fusion protein of the expressed insulin glargine precursor, and the fusion protein of the...
Embodiment 2
[0053] Example 2: Construction of genetically engineered bacteria using Pichia pastoris expression system
[0054] The preferred codons of Pichia pastoris were selected, and the gene fragment expressing the precursor of insulin glargine was obtained by fusion PCR technology, and the amino acid sequence translated was FVNQHLCGSHLVEALYLVCGERGFFYTPKTRRKGIVEQCCTSICSLYQLENYCG. In order to improve the cleavage efficiency of the signal peptide and ensure the integrity of the N-terminus, the Add the connection fragment KREEAEAEAEPK, introduce the XhoIEcoRI restriction site and connect it into the vector pPIC9, then clone it into the expression vector pPIC9k with SalI / SacI, and obtain the genetically engineered bacteria expressing the precursor of insulin glargine after conventional genetic engineering. Take the fermentation broth for TricineSDS-PAGE analysis, the results are shown in the attached image 3 , with image 3 The target protein band in is the secreted and expressed insuli...
Embodiment 3
[0055] Embodiment 3: crude pure expression product
[0056] Escherichia coli expression product in Example 1, with 50mMPB+2mMEDTA, pH7.5 breaks up the bacteria; With 50mMTris-HCl+2mMEDTA+0.5%TritonX-100, pH8.0; 50mMTris-HCl+2mMEDTA+1MUrea, wash successively with pH8.0 package; denatured with 50mMTris-HCl+2mMEDTA+8MUrea, pH9.0; sulfonated with 50mMTris-HCl+2mMEDTA+8MUrea+0.3MNa2SO3, pH9.0; renatured with 50mMGly+2mMEDTA+1MUrea+1mMβ-Me, pH9.5, Put on the Q column, and obtain the crude and pure precursor protein after pH 8.0 salt concentration gradient elution, SDS-PAGE analysis, the results are shown in the appendix Figure 4 , the results show that the precursor protein with higher purity can be obtained after renaturation crude purification, the molecular weight is about 17.8KD, and the main impurity is the dimer formed in the renaturation process.
[0057] In Example 2, the yeast expression product was diluted and adjusted to pH 4.0, and eluted with pH and salt gradient on a...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 