Phycocyanin hypoglycemic polypeptide
A phycocyanin and hypoglycemic technology, which is applied in the fields of peptides, depsipeptides, cardiovascular system diseases, etc., can solve the problems of loss of active ingredients of spirulina dry powder, inability to eliminate the fishy smell of spirulina, and low yield of active polypeptides. The effect of avoiding protein denaturation, shortening extraction time, and improving peptide yield
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0015] A phycocyanin hypoglycemic polypeptide, the preparation steps of the hypoglycemic polypeptide are:
[0016] 1) Cell crushing: prepare algae liquid, the solid-to-liquid ratio of spirulina dry powder to water is 1:50, add 0.07% functional protein peptide of the weight of spirulina dry powder to the algae liquid, choose sodium phosphate buffer as the extraction solvent, The pH value of the sodium phosphate buffer solution is 7.0, at -20°C and 37°C, freeze-thaw repeatedly 5 times, 4h each time, centrifuge at 5000rpm for 30min, collect the supernatant to obtain the crude extract of phycocyanin, place in Store in the refrigerator at 4°C for later use; the amino acid sequence of the functional protein peptide is MKGLSFVLLVLLLLMMPDGEGDPEMQYWTGRGLCRRFCYEYFVGHHCPRRYRCCAIRA;
[0017] 2) Salting out: add (NH 4 ) 2 SO 4 The solution was brought to 80% saturation, left standing at 4°C for 12 hours, and centrifuged at 6000rpm for 15 minutes to obtain the salt-out precipitate;
[0...
Embodiment 2
[0023] A phycocyanin hypoglycemic polypeptide, the preparation steps of the hypoglycemic polypeptide are:
[0024] 1) Cell crushing: prepare algae liquid, the solid-liquid ratio of spirulina dry powder to water is 1:50, add 0.08% functional protein peptide of the weight of spirulina dry powder to the algae liquid, choose sodium phosphate buffer as the extraction solvent, The pH value of the sodium phosphate buffer solution is 7.0, at -20°C and 37°C, freeze-thaw repeatedly 5 times, 4h each time, centrifuge at 5000rpm for 30min, collect the supernatant to obtain the crude extract of phycocyanin, place in Store in the refrigerator at 4°C for later use; the amino acid sequence of the functional protein peptide is MKGLSFVLLVLLLLMMPDGEGDPEMQYWTGRGLCRRFCYEYFVGHHCPRRYRCCAIRA. The active peptide is hydrophilic and lipophilic. The hydrophilicity makes it soluble in distilled water, and the lipophilicity makes it combine with the cell membrane of Spirulina to form small holes under the c...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com