Application of mimic antigen compound in treatment of HBV infection related symptoms

A compound and antigen technology, applied in the direction of antibody medical components, virus antigen components, microorganisms, etc., to achieve the effect of reducing serum ALT levels and repairing damaged liver cells

Inactive Publication Date: 2018-07-17
ARMY MEDICAL UNIV
View PDF4 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, there is currently no report on the use of the mimic antigen polypeptide for the clinical treatment of symptoms associated with HBV infection

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of mimic antigen compound in treatment of HBV infection related symptoms
  • Application of mimic antigen compound in treatment of HBV infection related symptoms
  • Application of mimic antigen compound in treatment of HBV infection related symptoms

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0039] Example 1: Synthesis and purification of mimetic antigen compounds

[0040] 1) Synthesis of mimic antigen compounds

[0041] The sequence of the mimetic antigen compound of the present invention is ε-CH 3 (CH 2 ) 14 CO-(NH)-KSSQYIKANSKFIGITEAAFLPSDFFPSVGGGDPRVRGLYFPA was synthesized by Fmoc solid phase synthesis.

[0042] The fixed carboxy-terminus extends the peptide chain from the C-terminus to the N-terminus. Performed on an Applied Biosystems 431A peptide synthesizer. Fmoc amino acids are used as raw materials, the loading amount is 1mM, and the side chain protections are: Ser(tBu), Thr(tBu), Tyr(tBu), His(Trt), Gln(Trt), ASP(OtBu), Glu(OtBu), Arg(Pmc). HMP-resin was selected as the solid phase carrier, the loading amount was 0.25mM, and the raw material / resin ratio was 4:1. The amino acid coupled to the resin (the first amino acid at the carboxyl end of the polypeptide) is activated by the symmetrical anhydride activation method, and the activation of the re...

Embodiment 2

[0057] Embodiment 2: the preparation of mimetic antigen compound-liposome

[0058] 1) Preparation of mimetic antigen compound-liposome by secondary emulsification method: dissolve the lipid component in ether solution, then mix with the concentrated solution of mimetic antigen compound obtained in Example 1 to form an emulsion (W / O) , injected into phosphate buffered saline (PB) or water, while controlling the temperature and stirring, forming an emulsion (W / O / W) for the second time, and gradually forming the mimic antigen compound-liposome with the volatilization of ether. Through ultrafiltration device and dialysis (the dialysis ratio must reach more than 200 times) and 10μm microporous membrane filtration, to remove the mimetic antigen compound-liposome that may be free and possibly aggregated and precipitated in the liquid, that is, to obtain the mimetic antigen compound- Liposome Concentrate. Then add 140mL of 20% mannitol aqueous solution, 30mL of 20% human serum albumi...

Embodiment 3

[0061] Embodiment 3: The therapeutic effect of mimetic antigen compound-liposome in chronic hepatitis B patient

[0062] In this example, the antigen-mimicking compound-liposome finished product prepared in Example 1 is used to treat selected patients with chronic hepatitis B, and to study its therapeutic effect and effect on chronic hepatitis B disease.

[0063] (1) Selection of subjects:

[0064] In the first stage (0-76 weeks), 360 HBeAg-positive chronic hepatitis B patients were selected as treatment objects. Divided into the following 3 groups, each group of 120 subjects: one group was given 600 μg mimic antigen compound-liposome+300 μg empty liposome (600 μg treatment group); one group was given 900 μg mimic antigen compound-liposome (900 μg treatment group). group); one group was given 900 μg of empty liposomes (control group).

[0065] The second stage (76-144 weeks): Among the three groups of subjects who completed the 76-week study above, if there is a virological ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
diameteraaaaaaaaaa
Login to View More

Abstract

The invention relates to application of a mimic antigen compound in treatment of HBV infection related symptoms. The method is characterized in that mimic antigen compound with effective treatment dosage and containing the following two parts is applied to testers with the HBV infection related symptoms: (1) epsilon-CH3(CH2)14CO-(NH)-KSSQYIKANSKFIGITE and (2) AAAFLPSDFFPSVGGGDPRVRGLYFPA. With theadoption of the method, serum HBeAb seroconversion of a HBV infection patient and HBeAg / HBeAb serological transformation are induced, so that the serum HBV DNA level of the patient can be reduced, the serum ALT level is reduced, and the damaged liver cells can be recovered. Therefore, the method can be treated as an effective method for treating the HBV infection related symptoms.

Description

technical field [0001] The present invention relates to the use of a mimetic antigen compound for treating symptoms related to HBV infection. Background technique [0002] Chronic hepatitis B (referred to as hepatitis B) is a disease caused by hepatitis B virus (Hepatitis B virus, HBV), mainly characterized by liver inflammatory lesions and can cause multiple organ damage. Hepatitis B is prevalent worldwide, but the prevalence varies greatly in different regions. my country is a high prevalence area of ​​hepatitis B, and the positive rate of HBsAg in the general population is 9.09%. It is difficult to cure, the prognosis is poor, and it seriously endangers health. The current treatment for hepatitis B mainly includes antiviral therapy, immunomodulatory therapy, anti-inflammatory therapy and anti-fibrosis therapy. The effective anti-HBV drugs recognized at home and abroad mainly include interferons and nucleoside (acid) analogues, each with its own advantages and disadvanta...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): A61K39/29A61K9/127A61P1/16A61P31/20
CPCA61K9/127A61K39/12A61K2039/545C12N2730/10134
Inventor吴玉章
OwnerARMY MEDICAL UNIV