Polypeptide for preparing ELISA mouse monoclonal coating antibody and rabbit polyclonal detection antibody and application thereof
A monoclonal antibody and polyclonal antibody technology, applied in the field of biomedicine, can solve the problem of blank clinical detection kits and related targeted drugs, and achieve the effect of strong immunogenicity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0029] Example 1 Synthesis of the Antigen Peptide of the Class 1 Anaphylaxis Specific Receptor MRGPRX2 Protein
[0030] DNAstar analysis software was used to predict and analyze the epitope of human MRGPRX2 amino acid sequence, such as protein hydrophilicity, sequence flexibility, protein surface accessibility, and protein antigenic index, and finally determined the 286-330th position as the target, amino acid The sequence is:
[0031] RKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQGTPEMRSRSSLV.
[0032] The manual solid-phase Fmoc method is used to synthesize from the C-terminal to the N-terminal direction to obtain the crude product of the target polypeptide. Purify the target polypeptide by using reversed-phase high-performance liquid chromatography (HPLC) method to separate different polypeptide molecules according to the difference in hydrophobicity. After freeze-drying the solvent, the pure polypeptide in a fluffy state was obtained. Its chemical structure was characterized by MALD...
Embodiment 2
[0034] Embodiment 2 Preparation of anti-polypeptide mouse monoclonal antibody
[0035] Prepare the conjugated KLH-polypeptide into an emulsified injection for immunization, and inject subcutaneously in points, spray alcohol on the back midline of the mouse, avoid the parts with immune swellings, and inject one injection into four times, respectively. 4 different points. After five immunizations, blood was collected from the tail vein of the mice to detect the titer of antiserum by indirect ELISA. The titer of ELISA antiserum reached 1:50000, indicating that the immunity was qualified. Select the mouse with the highest titer for fusion screening, and then carry out subcloning, and screen pure monoclonal cell lines according to the results of subcloning. The supernatant of the monoclonal cell line was injected into mice to prepare ascites, and the ascites was subjected to protein G affinity purification to obtain purified monoclonal antibodies.
Embodiment 3
[0036] Example 3 Antibody identification using indirect ELISA method to detect monoclonal antibody titer
[0037] 1) ELISA plate preparation: After assembling the ELISA plate, prepare for antigen coating.
[0038] 2) Antigen dilution and coating: Add the prepared antigen working solution into the concave sample addition tank, and use a 300 μL range 8-well pipette to take 100 μL of the antigen working solution and add it to the bottom of the well of the ELISA plate. Incubate in aluminum foil for 2 h at 37°C or overnight at 4°C.
[0039] 3) Wash the plate: Take out the ELISA plate that has been coated with the antigen, remove the liquid in the well by inverting it, and then place it on a clean absorbent towel to drain; add 200ml of TBST to each well with a drain gun until it is full but not enough. Overflow, after the whole plate is added and left for 3 minutes, the TBST is thrown out, thrown 3 times, and then placed on a clean absorbent towel to drain, and each plate is patted 6...
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com