A pig-derived glp-2 recombinant plantarum lactobacillus with site-specific transformation and its preparation method and application
A technology of GLP-2 and Lactobacillus plantarum, which is applied in the field of pig-derived GLP-2 recombinant Lactobacillus plantarum and its preparation, can solve problems such as short half-life, achieve high expression, high biological activity, and improve the effect of application value
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0034] 1. Site-directed transformation and primer design of p(Gly2)-GLP-2 gene: The porcine GLP-2 gene sequence (Accession No.NP_999489.1) was obtained from GenBank, and the site-directed transformation was carried out. The alanine at the second position is replaced by glycine to form p(Gly2)-GLP-2 that is not digested by DPP-IV and prolong its half-life.
[0035] Wherein, the amino acid sequence of p(Gly2)-GLP-2 is SEQ ID NO:1.
[0036] SEQ ID NO: 1: HGDGSFSDEMNTVLDNLATRDFINWLLHTKITDSL.
[0037] The codon bias tropism of Lactobacillus plantarum was modified on the sequence, and the optimized sequence was SEQ ID NO:2.
[0038] SEQ ID NO: 2:
[0039] CACGGTGATGGTTCATTCTCAGATGAAATGAACACTGTTTTAGATAACTTAGCTACTCGTGATTTCATCAACTGGTTATTACACACTAAGATCACTGATTCATTA.
[0040] Two pairs of primers were designed and fused to form p(Gly2)-GLP-2 by overlap extension PCR. The 5' end of primer P1 introduces restriction site XhoI, the 3' end of primer P4 introduces restriction site Sac I, and...
Embodiment 2
[0053] 1. Expression of the target gene in Lactobacillus plantarum and identification of its expression product: pick the transformed positive recombinant bacteria pSCPSP-p(Gly2)-GLP-2-LP-1 and empty vector pSCPSP-LP-1 and inoculate in MRS liquid medium (containing 20 µg / mL chloramphenicol) was cultured overnight. Then inoculate the above-mentioned overnight cultured bacterial solution into an appropriate amount of MRS solution at a ratio of 2%, culture it at 37°C for 24 hours, and take its supernatant. The supernatant was desalted first, then ultrafiltered with a 1KD ultrafiltration tube and centrifuged at 4°C for 30 min, and the filtrate was discarded. The remaining supernatant was subjected to 10KD ultrafiltration and centrifugation, and the collected filtrate was placed in a vacuum drying oven at 37°C to concentrate 100 times, added 2×Tricine polypeptide loading buffer, and boiled for 10 minutes. Centrifuge at 11000r / min, 4°C for 10min. Take the supernatant of pSCPSP-p(G...
Embodiment 3
[0059]1. The establishment of chronic enteritis model in mice and the treatment of enteritis by p(Gly2)-GLP-2: DSS (dextran sodium sulfate): enteritis research (IBD) level - the gold standard for enteritis research (molecular weight 36,000-50,000Da ). The mechanism of DSS-induced enteritis is that the toxicity of DSS directly acts on the epithelial cells at the colonic crypts, affecting the integrity of the mucosa, making the crypts shallower, and the intestinal villi shrinking, leading to enteritis.
[0060] In view of the fact that the severity of DSS-induced colitis does not depend on the amount of DSS intake, but is determined by the concentration of DSS, when the difference in the amount of DSS that mice drink is small, it does not affect the severity of the induced colitis. This experiment adopts the method of free drinking water modeling. In order to verify the biological activity of the expression product p(Gly2)-GLP-2 in vivo, the model was constructed according to t...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


