Gulfweed polysaccharide-based edible packaging film
A technology of sargassum polysaccharide and packaging film, which is applied in packaging, wrapping paper, transportation and packaging, etc. It can solve the problems of unsatisfactory food oxidation degree, unfavorable food quality and freshness preservation, etc., and achieve good instant solubility and mechanical properties, and delay Oxidation time, the effect of raw material availability
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0012] An edible packaging film based on sargassum polysaccharides, the components and parts by weight of the packaging film are: 62 parts of flour, 32 parts of sargassum polysaccharide, 8 parts of sucrose, 0.24 parts of active polypeptide, 7 parts of vegetables, 10 parts of eggs, chitosan 18 parts of sugar, 6 parts of water, the weight ratio of Sargassum polysaccharide to sucrose is 4:1; the amino acid sequence of the active polypeptide is: MKTVRVAAAVALLFAFVWIQESSAQADAQMEEMEGPEDVDIPVELKVEEVVDAMSSYSRAKRGLKCKLRCRL; the vegetables are spinach, green cabbage, celery and carrot.
[0013] A kind of preparation method of the edible packaging film based on Sargassum polysaccharide is:
[0014] 1) Extraction of Sargassum polysaccharides: take Sargassum powder, add deionized water according to the mass ratio, the ratio of Sargassum powder to deionized water is 1:20, reflux extraction, the reflux extraction temperature is 82 °C, and the extraction time is 7.1h , centrifuge the extract (...
Embodiment 2
[0017] An edible packaging film based on sargassum polysaccharide, the composition and preferred parts of the packaging film are: 59 parts of flour, 20 parts of sargassum polysaccharide, 10 parts of sucrose, 0.2 part of active polypeptide, 6 parts of vegetables, 10 parts of eggs, shell 18 parts of polysaccharide, 8 parts of water, the weight ratio of Sargassum polysaccharide to sucrose is 2:1; the amino acid sequence of the active polypeptide is: MKTVRVAAAVALLFAFVWIQESSAQADAQMEEMEGPEDVDIPVELKVEEVVDAMSSYSRAKRGLKCKLRCRL; the vegetables are spinach, celery, tomato and broccoli.
[0018] A kind of preparation method of the edible packaging film based on Sargassum polysaccharide is:
[0019] 1) Extraction of Sargassum polysaccharides: take Sargassum powder, add deionized water according to the mass ratio, the ratio of Sargassum powder to deionized water is 1:20, reflux extraction, the reflux extraction temperature is 82 °C, and the extraction time is 7.1h , centrifuge the extract (...
PUM
| Property | Measurement | Unit |
|---|---|---|
| thickness | aaaaa | aaaaa |
| thickness | aaaaa | aaaaa |
| thickness | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More