Gulfweed polysaccharide-based edible packaging film

A technology of sargassum polysaccharide and packaging film, which is applied in packaging, wrapping paper, transportation and packaging, etc. It can solve the problems of unsatisfactory food oxidation degree, unfavorable food quality and freshness preservation, etc., and achieve good instant solubility and mechanical properties, and delay Oxidation time, the effect of raw material availability

Inactive Publication Date: 2017-11-17
浦江县欧立生物技术有限公司
View PDF6 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Moreover, the process is simple and the production cost is low, but the packaging film is not ideal in delaying the oxidation degree of the coated food, which is not conducive to the quality and freshness of the food.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0012] An edible packaging film based on sargassum polysaccharides, the components and parts by weight of the packaging film are: 62 parts of flour, 32 parts of sargassum polysaccharide, 8 parts of sucrose, 0.24 parts of active polypeptide, 7 parts of vegetables, 10 parts of eggs, chitosan 18 parts of sugar, 6 parts of water, the weight ratio of Sargassum polysaccharide to sucrose is 4:1; the amino acid sequence of the active polypeptide is: MKTVRVAAAVALLFAFVWIQESSAQADAQMEEMEGPEDVDIPVELKVEEVVDAMSSYSRAKRGLKCKLRCRL; the vegetables are spinach, green cabbage, celery and carrot.

[0013] A kind of preparation method of the edible packaging film based on Sargassum polysaccharide is:

[0014] 1) Extraction of Sargassum polysaccharides: take Sargassum powder, add deionized water according to the mass ratio, the ratio of Sargassum powder to deionized water is 1:20, reflux extraction, the reflux extraction temperature is 82 °C, and the extraction time is 7.1h , centrifuge the extract (...

Embodiment 2

[0017] An edible packaging film based on sargassum polysaccharide, the composition and preferred parts of the packaging film are: 59 parts of flour, 20 parts of sargassum polysaccharide, 10 parts of sucrose, 0.2 part of active polypeptide, 6 parts of vegetables, 10 parts of eggs, shell 18 parts of polysaccharide, 8 parts of water, the weight ratio of Sargassum polysaccharide to sucrose is 2:1; the amino acid sequence of the active polypeptide is: MKTVRVAAAVALLFAFVWIQESSAQADAQMEEMEGPEDVDIPVELKVEEVVDAMSSYSRAKRGLKCKLRCRL; the vegetables are spinach, celery, tomato and broccoli.

[0018] A kind of preparation method of the edible packaging film based on Sargassum polysaccharide is:

[0019] 1) Extraction of Sargassum polysaccharides: take Sargassum powder, add deionized water according to the mass ratio, the ratio of Sargassum powder to deionized water is 1:20, reflux extraction, the reflux extraction temperature is 82 °C, and the extraction time is 7.1h , centrifuge the extract (...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
thicknessaaaaaaaaaa
thicknessaaaaaaaaaa
thicknessaaaaaaaaaa
Login to View More

Abstract

The invention discloses a gulfweed polysaccharide-based edible packaging film. The packaging film comprises, by weight, 56-82 parts of wheat flour, 20-38 parts of gulfweed polysaccharides, 2-10 parts of sucrose, 0.2-0.3 part of active polypeptides, 2-10 parts of vegetables, 5-15 parts of eggs, 10-25 parts of chitosan and 2-10 parts of water, and a weight ratio of the gulfweed polysaccharides to the sucrose is (2-15):1. Materials daily eaten by people are adopted as the raw materials of the packaging film, so the produced packaging film can be used as a packaging film for foods and medicines, has good instant solubility and mechanical performances, also can be used as a food to relieve hunger, and can remove free radials on the surfaces of the foods, delay the oxidation time of the foods and facilitate the prolongation of the shelf life of the foods and the improvement of the quality of the foods when used for packaging fresh vegetables or meat products.

Description

technical field [0001] The invention relates to an edible packaging film, in particular to an edible packaging film based on sargassum polysaccharide. Background technique [0002] Polysaccharide film is made of various polysaccharides (such as starch, chitosan, cellulose, sodium alginate, colloid, etc.) as the main raw material. It is a kind of edible packaging film that has been studied and applied earlier. advanced features. Polysaccharide films are chemically stable and suitable for long-term storage, but generally have poor water resistance. The protein film is made of plant protein (such as soybean protein, corn protein, wheat gluten, etc.) and animal protein (such as whey protein, egg white protein, fish myofibril protein, etc.), and is cross-linked with polypeptide chains through disulfide bonds film forming. The protein film is easy to digest, rich in nutrition, good mechanical properties, and has excellent oxygen, carbon dioxide and oil barrier properties, but p...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C08L99/00C08L5/00C08L5/08C08L89/00C08K5/1545C08B37/00C08J5/18B65D65/46
CPCC08L99/00B65D65/463C08B37/0003C08J5/18C08J2399/00C08J2405/00C08L2201/06C08L2203/16C08L2205/035C08L5/00C08L5/08C08L89/00C08K5/1545
Inventor李冰
Owner浦江县欧立生物技术有限公司