Macadamia plant defensin and its application
A technology of plant defensins and nuts, which is applied in the field of biotechnology and genetic engineering to achieve the effects of promoting expression, increasing the survival rate of animals challenged with viruses, and inhibiting growth
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0061] Cloning of Example 1 Macadamia Nut Plant Defensin Protein Gene
[0062] The sequence of macadamia plant defensin protein gene is:
[0063] ATTCAGGGGTTTGTGCTTAAGCCACGGAACTGTGCTAATGTGTGTCGGACTGAGGGTTTTCCCGGCGGTACTTGCAAAGGGTTCCGGCGTCGTTGCTTCTGTGAGAAGAATTGTCAT
[0064] The amino acid sequence of the encoded protein macadamia plant defensin is:
[0065] IQGFVLKPRNCANVCRTEGFPGGTCKGFRRRCFCEKNCH (shown in SEQ ID No.1)
[0066] There are deficiencies in the application of yeast expression system to express the target protein of exogenous gene, such as internal degradation, heterogeneous product, multimer formation, incomplete addition of signal peptide, etc., resulting in significant differences in the structure of the expressed protein. At the same time, excessive glycosylation of the expressed product will reduce the activity of the protein. The study found that the gene could not be expressed in yeast. Therefore, using bioinformatics analysis tools, the expression efficien...
Embodiment 2
[0081] Construction and identification of embodiment 2pYCT2-a recombinant expression vector
[0082] The cloning product of AZJG-DEFENSIN gene was double-digested with XhoI and XbaI to digest the plasmid, and the target fragment was recovered and ligated with the same double-digested secreted expression vector pYCa under the action of IN-FUSION ligase, and transformed into competent cells of INVSC1 Saccharomyces cerevisiae by electric shock , obtained pYCa-AZJG-DEFENSIN positive recombinant yeast, named AZJG-DEFENSIN recombinant yeast, and obtained positive recombinant transformants by screening on yeast selection medium SD-U plate; cultured colonies were extracted for plasmid PCR and XhoI and XbaI double enzyme digestion identification ( figure 1 ), gel electrophoresis showed that a single band appeared at all sizes, and the size was in line with expectations, proving that the recombinant pYCa plasmid was successfully constructed ( figure 2 ); Sequencing confirmed the corre...
Embodiment 3
[0083] Example 3 Expression Detection of Target Gene in RNA Level in Recombinant Saccharomyces
[0084] AZJG-DEFENSIN recombinant yeast was inoculated in uracil auxotrophic medium at 28°C, cultured overnight at 200 rpm, and centrifuged to obtain AZJG-DEFENSIN recombinant yeast cell. Extract the total RNA of the bacteria, and use the primer pair (F: 5'-ATGTATAAGATGCAGCTCTTGT-3' (SEQ ID No.6) and R: 5'-CTAATGGTGATGGTGATGAT-3' (SEQ ID No.7)) to detect the AZJG-DEFENSIN recombinant yeast The expression level of the target gene. The results showed that the size of the target band (122bp) in AZJG-DEFENSIN recombinant yeast was consistent with that of the marker band near the 100-150 interval. It indicated that the AZJG-DEFENSIN gene in the AZJG-DEFENSIN recombinant yeast was expressed. see image 3 .
PUM
| Property | Measurement | Unit |
|---|---|---|
| molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 


