Unlock instant, AI-driven research and patent intelligence for your innovation.

Antibacterial peptide and mitochondrial DNA complex, polyclonal antibody of complex and application of polyclonal antibody

A polyclonal antibody and antimicrobial peptide technology, applied in the field of medicine, can solve the problem of increased risk and achieve good targeting effect, high potency and good antibody quality

Active Publication Date: 2020-02-21
KUNMING INST OF ZOOLOGY CHINESE ACAD OF SCI
View PDF2 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

At the same time, the pharmaceutical company of HUMIRA announced that the combination of Adalimumab and Anakinra will lead to an exacerbation of this risk, which makes the plan to reduce the production of immunosuppressant antibodies through combination drugs come to naught

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antibacterial peptide and mitochondrial DNA complex, polyclonal antibody of complex and application of polyclonal antibody
  • Antibacterial peptide and mitochondrial DNA complex, polyclonal antibody of complex and application of polyclonal antibody
  • Antibacterial peptide and mitochondrial DNA complex, polyclonal antibody of complex and application of polyclonal antibody

Examples

Experimental program
Comparison scheme
Effect test

preparation example Construction

[0025] In the present invention, the complex of the antimicrobial peptide and mitochondrial DNA is preferably a liquid preparation, and the solvent of the liquid preparation is preferably a phosphate buffer; the pH value of the phosphate buffer is preferably 7.4; in the present invention, The concentration of the antimicrobial peptide and mitochondrial DNA complex in the liquid preparation is 1.0-1.5 mg / mL, more preferably 1.2 mg / mL. In the present invention, the preparation method of the liquid preparation preferably includes the following steps: dissolving the complex of the antibacterial peptide and mitochondrial DNA in phosphate buffer, and incubating at 35-38° C. for 20-40 min. In the specific implementation process of the present invention, it is preferred to dissolve the antimicrobial peptide and mitochondrial DNA in phosphate buffer and incubate, the temperature of the incubation is preferably 37°C, and the incubation time is preferably 25-35min, more preferably 30min....

Embodiment 1

[0030] Mitochondrial DNA (mtDNA) Extraction:

[0031] Animal tissue / cell mitochondrial DNA extraction kit (GMS20023.3v.A, GENMED) was used to extract mtDNA from human embryonic kidney cells (HEK293). For details, see the kit instructions. The concentration of the obtained mtDNA was detected by a spectrophotometer (Nano, MestroGen), and the next experiment was carried out after confirming that there was no protein and DNA cross-contamination. (Purity requirements: A260 / A280>1.8, A260 / A280>2.0).

[0032] Peptide synthesis:

[0033] Solid-phase synthesis of peptides (entrusted to biotechnology companies):

[0034] LL-37: [LL-37, 37 aa]

[0035] Peptide Cramp: GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

[0036] The synthesizer was type 433A (ABI, USA). The correctness of the synthesized sequence was double verified by reversed-phase high-performance liquid chromatography (RP-HPLC) and matrix-assisted laser desorption ionization time-of-flight mass spectrometry (M...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides an antibacterial peptide and mitochondrial DNA complex, a polyclonal antibody of the complex and an application of the polyclonal antibody, and belongs to the technical field ofbiomedicine. The antibacterial peptide and mitochondrial DNA complex includes an antibacterial peptide and a mitochondrial DNA, wherein the mass ratio of the antibacterial peptide to the mitochondrial DNA is (3-5):1; and the antibacterial peptide includes LL-37 or Cramp. The invention also provides the polyclonal antibody of the antibacterial peptide and mitochondrial DNA complex, and the polyclonal antibody is obtained by immunizing animals by using the antibacterial peptide and mitochondrial DNA complex. The polyclonal antibody prepared by using the antibacterial peptide and mitochondrial DNA complex has a high yield, good specificity, and high titer, has a good targeting effect on the complex, and has a very good therapeutic effect on rheumatoid arthritis.

Description

technical field [0001] The invention belongs to the technical field of medicine, and in particular relates to a compound of antibacterial peptide and mitochondrial DNA, polyclonal antibody and application thereof. Background technique [0002] Rheumatoid arthritis (RA) is a symmetrical polyarthritis that mainly affects small joints such as metacarpophalangeal joints, proximal interphalangeal joints, and wrist joints. Long-term bone erosion and bone deformation will lead to limited mobility of patients. If the disease is not well controlled, it will lead to lifelong disability of the patient. As early as thousands of years ago, American Indians discovered RA-related cases, and related diseases were reported in Europe in the middle of the seventeenth century, and the upper class was the main group of patients (Firestein, G.S., Evolving concepts of rheumatoid arthritis. Nature, 2003.423(6937):p.356-61.). In my country, the research on RA belongs to the category of "bi syndrom...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A61K39/395C07K16/06C07K16/18C07K16/44A61P19/02A61K38/17
CPCA61K38/1709A61K39/395A61P19/02A61P37/02C07K16/065C07K16/18C07K16/44C07K2317/20
Inventor 赖仞孟平
Owner KUNMING INST OF ZOOLOGY CHINESE ACAD OF SCI