Application of Cucumber Phloem Lectin cspl1 in Resistance to Cucurbit Blight
A phloem and lectin technology, applied in the fields of plant molecular biology and plant genetic engineering, can solve the problems of undisclosed anti-epidemic diseases, and achieve the effect of improving resistance and wide application prospects
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0041] Example 1 Construction of cucumber CsPS1 gene overexpression vector and silencing vector
[0042] The protein encoded by the cucumber CsPL1 gene is Phloem lectin, which can specifically bind monosaccharides or polysaccharides. The full-length construction of the cucumber CsPL1 gene CDS into pGWB5 (the vector map is as follows figure 1 As shown), the overexpression vector was obtained; the cucumber gene CDS non-conserved segment about 200bp length fragment and its complementary fragment were constructed into pK7GWIW (vector map as shown in figure 2 shown), the gene silencing vector was obtained.
[0043] The amino acid sequence of cucumber phloem lectin CsPL1 is (154aa):
[0044] MAGQSTHYLAFPRASTITWGDDTRYWSWATVDFCSYAIEEARLLQVSWFDCRWSMDASDFKQDIWYNASVEVMLTSNASGWNVPLHLEIELPDGSKQESQIVLAGRQPNVWLKIPIGKFILRGSLTSGTIRFGLYNHEGNWKRGLNIRALAIQA (SEQ ID NO. 1).
[0045] Cucumber phloem lectin CsPL1 gene CDS (462bp) sequence is:
[0046]ATGGCAGGCCAAAGCACACATTATTTGGCATTTCCAAGAGCTTC...
Embodiment 2
[0051] Example 2 Constructing a Cucumber Cotyledon Model of Transient Overexpression / Gene Silencing
[0052] (1) The overexpression vector and the silencing vector constructed in Example 1 were respectively transformed into Agrobacterium GV3101, and cultured upside down on the corresponding resistant medium for 48-72 hours.
[0053] (2) Pick a single clone
[0054] Add it to 4 mL of LB medium containing the corresponding antibiotics and rifampicin, shake the bacteria at 180 rpm for 24-36 hours at 28°C.
[0055] (3) Add fresh LB medium containing corresponding antibiotics and rifampicin at a ratio of 1:100, shake the bacteria at 28°C and 180 rpm until the OD600 value is about 3.0.
[0056] (4) Centrifuge at 3000rpm for 5 minutes to collect the bacteria, and use the suspension (10mM MES, 10mM MgCl 2 ) to resuspend the cells, adjust the OD600 value to about 0.4, and add 200 mM acetosyringone.
[0057] (5) Stand at room temperature for 3-5 hours.
[0058] (6) Prick a needle ho...
Embodiment 3
[0071] Example 3 Cucumber cotyledon disease resistance experiment
[0072] Taking the cucumber cotyledon model with transient overexpression of CsPL1 successfully constructed in Example 2, the cucumber cotyledon model of CsPL1 gene silencing, and the wild-type cucumber cotyledon, the cucumber seedlings after injection were cultured in the dark for 12 hours, and then cultured in the light at 22°C for 3 to 4 days. Cucumber cotyledons were isolated and inoculated with Phytophthora cucurbiti, and cultured in a culture dish at 28°C for 24 hours in the dark.
[0073] The resistance function of the target gene to the disease was judged according to the size of the lesions on the isolated cucumber cotyledons of different treatments. The results are shown in the attached Figure 5 shown.
[0074] The results showed that transient overexpression of CsPL1 gene in cucumber cotyledon can significantly enhance the resistance of cucumber cotyledon to blight compared with the control, while ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


