Time-resolved immunochromatography test strip and kit for detecting S100B protein as well as preparation method and application of time-resolved immunochromatography test strip
An immunochromatographic test paper and time-resolving technology, which is applied in the biological field, can solve the problems of the stable period of the kit and the short half-life of the nuclide, the high price of the fluorescent immunoassay, and the complicated operation, so as to reduce the process of preparing the binding pad and improve the The effect of sensitivity and simple preparation process
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0042] The present invention also provides a preparation method of a time-resolved immunochromatographic test strip, the preparation method comprising:
[0043] Coating membrane processing step: respectively immobilizing the S100B monoclonal capture antibody and goat anti-rabbit IgG antibody recognizing a single epitope on the coating membrane to form a detection area and a control area;
[0044] Sample pad processing steps: prepare fluorescent microsphere-labeled S100B polyclonal detection antibody and fluorescent microsphere-labeled rabbit IgG, and spray on the sample pad;
[0045] Assembly steps: Lap and paste the sample pad, coating film and absorbent paper on the backing in sequence.
[0046] As a further preferred solution, in the sample pad processing step of the present invention, the method for preparing the S100B polyclonal detection antibody labeled with fluorescent microspheres is as follows:
[0047] (1) Dialyze the S100B polyclonal detection antibody overnight, ...
Embodiment 1
[0054] Example 1: Screening of S100B Antibody
[0055] In this example, conventional serum experiments were used to select monoclonal capture antibodies and The polyclonal labeled antibodies were paired for experiments, as shown in Table 1 below. In the experiment, 12 groups of paired experiments were set up, and each group was tested with 10 S100B negative and positive serum samples. The composition of the 12 groups of paired experiments is shown in Table 2. For the paired results, see Figure 1-12 .
[0056] Table 1: Antibody Pairing Experiment Table
[0057]
[0058] The sequence of AB2 is SEQ ID NO: 1, the sequence of AB3 is SEQ ID NO: 2, AB1 is the antibody with the article number V01003 produced by Nanjing GenScript Biotechnology Co., Ltd., and AB4 is the antibody produced by Nanjing GenScript Biotechnology Co., Ltd. The antibody produced by the company is V01001.
[0059] SEQ ID NO: 1: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
[0060] SEQ ID ...
Embodiment 2
[0068]A time-resolved immunochromatographic test strip for detecting S100B, comprising a substrate, a sample pad, a coating film and absorbent paper sequentially arranged on the substrate, the sample pad is coated with S100B marked with fluorescent microspheres Polyclonal labeled antibody (SEQ ID NO: 1, derived from Raybiotech, CAT#144-00676) and rabbit IgG labeled with fluorescent microspheres (Hangzhou Boyin Biotechnology Co., Ltd., Cat. No.: N160701), the coated membrane includes parallel settings , and a detection area and a control area at a distance of 0.5 cm from each other, the detection area is close to the absorbent paper, the control area is close to the sample pad, and the detection area is coated with S100B polyclonal capture that recognizes a single antigenic epitope Antibody (SEQ ID NO: 2, derived from Ruiboao (Guangzhou) Biotechnology Co., Ltd.), and the control area was coated with goat anti-rabbit IgG antibody (Hangzhou Boyin Biotechnology Co., Ltd., catalog n...
PUM
Property | Measurement | Unit |
---|---|---|
diameter | aaaaa | aaaaa |
width | aaaaa | aaaaa |
transmittivity | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com