Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor

a single-domain antibody and tumour necrosis factor technology, applied in the field of polypeptides, can solve the problems of difficult and long development process, conventional antibodies are difficult to raise against multi-meric proteins, and none of the presently available drugs are completely effective for treatment, etc., to achieve the effect of preventing and/or alleviating symptoms

Inactive Publication Date: 2007-04-05
ABLYNX NV
View PDF52 Cites 66 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Benefits of technology

The present invention relates to an anti-TNF-alpha polypeptide that includes at least one single domain antibody. The polypeptide can be used to treat disorders associated with high levels of TNF-alpha, such as rheumatoid arthritis, Crohn's disease, and ulcerative colitis. The polypeptide can also be used in combination with other single domain antibodies, such as anti-IFN-gamma and anti-TNF-receptor, for more effective treatment. The invention also includes a method for identifying agents that can modulate the binding of the anti-TNF-alpha polypeptide to TNF-alpha.

Problems solved by technology

Yet none of the presently available drugs are completely effective for the treatment of autoimmune disease, and most are limited by severe toxicity.
In addition, it is extremely difficult and a lengthy process to develop a new chemical entity (NCE) with sufficient potency and selectivity to such target sequence.
However, conventional antibodies are difficult to raise against multimeric proteins where the receptor-binding domain of the ligand is embedded in a groove, as is the case with TNF-alpha.
The use of antibodies derived from sources such as mouse, sheep, goat, rabbit etc., and humanised derivatives thereof as a treatment for conditions which require a modulation of inflammation is problematic for several reasons.
Traditional antibodies are not stable at room temperature, and have to be refrigerated for preparation and storage, requiring necessary refrigerated laboratory equipment, storage and transport, which contribute towards time and expense.
Furthermore, the manufacture or small-scale production of said antibodies is expensive because the mammalian cellular systems necessary for the expression of intact and active antibodies require high levels of support in terms of time and equipment, and yields are very low.
Furthermore the large size of conventional antibodies, would restrict tissue penetration, for example, at the site of inflamed tissue.
Furthermore, traditional antibodies have a binding activity which depends upon pH, and hence are unsuitable for use in environments outside the usual physiological pH range such as, for example, in treating gastric bleeding, gastric surgery.
Furthermore, traditional antibodies are unstable at low or high pH and hence are not suitable for oral administration.
Furthermore, traditional antibodies have a binding activity, which depends upon temperature, and hence are unsuitable for use in assays or kits performed at temperatures outside biologically active-temperature ranges (e.g. 37±20° C.).
Another important drawback of conventional antibodies is that they are complex, large molecules and therefore relatively unstable, and they are sensitive to breakdown by proteases.
This means that conventional antibody drugs cannot be administered orally, sublingually, topically, nasally, vaginally, rectally or by inhalation because they are not resistant to the low pH at these sites, the action of proteases at these sites and in the blood and / or because of their large size.
Furthermore, subjects commonly experience physical and psychological stress prior to and upon receiving an injection.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
  • Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
  • Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor

Examples

Experimental program
Comparison scheme
Effect test

example 1

Example of Camelidae Antibodies Against Human Tumor Necrosis Factor Alpha

[0298] 1) Immunization and Library Constructions

[0299] A llama (Llama glama) was immunized with human TNF-alpha. For immunization, the cytokine was formulated as an emulsion with an appropriate, animal-friendly adjuvant (Specoll, CEDI Diagnostics B.V.). The antigen cocktail was administered by double-spot injections intramuscularly in the neck. The animal received 6 injections of the emulsion, containing 100 μg of TNF-alpha at weekly intervals. At different time points during immunization, 10-ml blood samples were collected from the animal and sera were prepared. The induction of an antigen specific humoral immune response was verified using the serum samples in an ELISA experiment with TNF (data not shown). Five days after the last immunization, a blood sample of 150 ml was collected. From this sample, conventional and heavy-chain antibodies (HcAbs) were fractionated (Lauwereys et al. 1998) and used in an EL...

example 2

Humanization of VHH#12B and VHH#3E by Site Directed Mutagenesis

[0315] 1) Homology between VHH#3E / VHH#12B and Human Germline Heavy Chain V-Region DP-47

[0316] Alignment of VHH#12B and a human VH3 germline sequence (DP-47) revealed a high degree of homology: [0317] 4 AA changes in FR1 on position 1, 5, 28 and 30 [0318] 5 AA changes in FR3 on position 74, 76, 83, 84 and 93 [0319] 1 AA change in FR4 on position 108

[0320] as represented in the following sequence alignment in which DP-47 is SEQ ID NO:101 and VHH#12B is SEQ ID NO:102:

DP-47EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYAMS WVRQAPGKGLEWVS AISGSGGSTYYVHH#12BQVQLQESGGGLVQPGGSLRLSCAASGFEFE NHWMY WVRQAPGKGLEWVS TVNTNGLITRYDP-47ADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK ------------- -----------VHH#12BADSVKG RFTISRDNAKYTLYLQMNSLKSEDTAVYYCTK VLPPYSDDSRTNAD WGQGTQVTVSS

[0321] A specific inhibitor for the TNF-alpha cytokine, with high homology to the human germline gene DP-47 was therefore an ideal candidate to further humanize and evaluate the i...

example 3

Isolation of Antagonistic VHH Against Mouse TNF-alpha

[0336] 1) Selection of Anti-Mouse TNF-alpha VHH

[0337] In order to perform efficacy studies in mouse models for IBD or Crohn's disease mouse TNF specific VHH were selected. Therefore a llama was immunized with mouse TNF-alpha as described in Example 1. RNA was extracted from PBL's sampled 4 and 10 days after the last immunization, as well as from a biopsy taken from a lymph node after day 4. Total RNA was converted in either random primed or oligo-dT primed cDNA and used as template for the amplification of the VHH encoding gene segments using Ig derived primers or a combination of oligo-dT primer and a single Ig primer (see example 1). With the Ig primers a library containing 8.5×107 clones was generated from the first PBL's, and a library with 7×106 clones for the second PBL sample and 5.8×108 clones for the lymph node. Using the combination of the oligo-dT primer and the Ig primer libraries from the first PBL sample were made ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
temperaturesaaaaaaaaaa
temperatureaaaaaaaaaa
pHaaaaaaaaaa
Login to View More

Abstract

The present invention relates to polypeptides derived from single domain heavy chain antibodies directed to Tumor Necrosis Factor-alpha. It further relates to single domain antibodies that are Camelidae VHHs. It further relates to methods of administering said polypeptides. It further relates to protocols for screening for agents that modulate the TNF-alpha receptor, and the agents resulting from said screening.

Description

RELATED APPLICATIONS [0001] This application is a continuation of U.S. patent application Ser. No. 10 / 534,348 filed May 9, 2005, currently pending, which is a National Stage of PCT / BE03 / 00192, filed Nov. 7, 2003, which claims priority to PCT / EP03 / 06581, filed Jun. 23, 2003 and PCT / EP03 / 07313, filed Jul. 8, 2003; this application also claims the benefit of U.S. provisional application Ser. No. 60 / 425,073, filed Nov. 8, 2002 and U.S. provisional application Ser. No. 60 / 425,063, filed Nov. 8, 2002.FIELD OF THE INVENTION [0002] The present invention provides polypeptides comprising one or more single domain antibodies directed towards tumor necrosis factor alpha (TNF-alpha). The present invention further relates to their use in diagnosis and therapy. Such antibodies may have a framework sequence with high homology to the human framework sequences. Compositions comprising antibodies to tumor necrosis factor alpha (TNF-alpha) alone or in combination with other drugs are described. BACKGRO...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(United States)
IPC IPC(8): A61K39/395C07K16/24C12Q1/68G01N33/53C07H21/04C12P21/06
CPCA61K2039/505C07K16/18C07K16/241C07K16/249C07K16/2863C07K16/2875C07K16/36C07K16/40C07K16/4291C07K2316/96C07K2317/22C07K2317/24C07K2317/31C07K2317/565C07K2317/569C07K2317/626C07K2317/92C07K2319/00C07K2317/34A61P19/02A61P31/00A61P31/04A61P35/00A61P37/06C07K2317/567C07K2317/76
InventorSILENCE, KARENLAUWEREYS, MARCDE HAARD, HANS
OwnerABLYNX NV