Ubiquitin-interacting motif-like structural domain of mycobacterium tuberculosis secretory protein
A Mycobacterium tuberculosis, binding domain technology, applied in the field of cell biology, can solve the problem of unclear influence of PtpA protein on cell signaling pathways
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0021] Example 1 The Ubiquitin Binding Domain (UIML Domain) of Mycobacterium Tuberculosis Secreted Protein PtpA
[0022] The domain of interaction between Mycobacterium tuberculosis secretory protein PtpA and ubiquitin, its amino acid sequence is:
[0023] PRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNG. The UIML domain and its structural analogues can be used in the screening of anti-tuberculosis drugs.
[0024] The preparation method of the PtpA UIML domain protein is to construct the recombinant plasmid pGEX-6P-1-PtpA-UIML containing the PtpA UIML domain gene, and transform the plasmid into Escherichia coli BL21, and use IPTG to induce protein expression at 30°C; Sonicate the bacteria, collect the supernatant after high-speed centrifugation; slowly flow the supernatant through the filled Glutathione-Sepharose beads (GE), then add column washing buffer to fully wash the column, and finally add 2-3ml eluent Elute the protein; add the collected eluate to a 10KD protein conce...
Embodiment 2
[0025] Example 2 Mycobacterium tuberculosis secreted protein PtpAUIML domain directly interacts with ubiquitin
[0026] Through the crystal structure analysis of the known PtpA and Ub proteins, it was found that there is an amino acid sequence (UIML domain) similar to the eukaryotic UIM domain in the PtpA protein ( figure 1 ), because there is a hydrophobic amino acid sequence similar to the eukaryotic UIM domain in this sequence, we believe that this domain may be related to the interaction of ubiquitin, and it is the first prokaryotic UIM domain we discovered. The UIML domain is not consistent with the reported eukaryotic UIM domain, which is our first discovery in a prokaryotic protein. At the same time, through crystal structure analysis, we think that the A140 site may be the key site of the hydrophobic interaction between PtpA protein and ubiquitin.
[0027] Through in vitro experiments, the A140 site mutated PtpA (A140E) protein and the wild-type PtpA protein were subj...
Embodiment 3
[0030] Example 3 Ubiquitin loses the ability to regulate the enzyme activity of the phosphatase PtpA (A140E) mutant
[0031] In the Chinese invention patent application 201310466907.2, it is recorded that Ub has a strong activation effect on the phosphatase activity of PtpA, thereby enhancing its activity to dephosphorylate the substrates p-JNK and p-P38.
[0032] After performing the same enzyme activity experiment, we found that because PtpA (A140E) lost the ability to interact with ubiquitin, its phosphatase activity was no longer regulated by ubiquitin ( image 3 ). Also in the dephosphorylation reaction in vitro, we also obtained the same result, that is, the dephosphorylation activity of PtpA (A140E) on the substrates p-JNK and p-P38 was no longer regulated by ubiquitin ( Figure 4 ).
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 
