Dried meat slice preparation method
A technology of jerky and minced meat, applied in protein-containing food ingredients, food science, etc., can solve the problems of color deterioration of meat products, unstable product flavor, excessive preservative dosage, etc., to improve tissue softness and product taste, Better texture and taste, and better quality
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0017] The preparation method of dried meat comprises chopping, pickling, spreading and sieving, drying and roasting, and the specific steps are as follows:
[0018] 1) Cutting and mixing: measure minced meat, salt, and compound phosphate according to the formula, then add functional protein peptides with a weight of 0.02‰ of the minced meat, and chop and mix for 8 minutes at a temperature of 6°C and a speed of 6500r / min to obtain chopped meat Meat mince, the amino acid sequence of the above functional protein peptide is TDHKKQDNAYASAIPRDMDRYSLYEENGFYTHCGPNFCCCIS, the functional protein peptide is positively charged, close to the cell membrane through electrostatic interaction, and then inserted into the outer membrane through hydrophobic interaction, resulting in the destruction of the outer membrane structure and increasing the permeability of the cell membrane Improve the breaking rate of chopping and mixing, so that the cytoplasm can be quickly dissociated. This step can qu...
Embodiment 2
[0024] The preparation method of jerky, its concrete steps are:
[0025] 1) Measure minced meat, salt, and compound phosphate according to the formula, then add functional protein peptides with a weight of 0.012‰ of minced meat, chop and mix for 12 minutes at a temperature of 12°C and a speed of 5500r / min to obtain minced meat. The amino acid sequence of the functional protein peptide is TDHKKQDNAYASAIPRDMDRYSLYEENGFYTHCGPNFCCCIS;
[0026] 2) Add cooking wine, five-spice powder, sugar, glucose, transglutaminase, carrageenan, and konjac gum in the prescribed amount to the minced meat, mix well, marinate at 3°C for 8 hours, take it out, and then get cured minced meat;
[0027] 3) Apply a layer of cooked vegetable oil on the sieve first, and then spread the marinated meat slices on the sieve. The spread sieve should be uniform, and there should be no gaps or overlaps between the meat slices, so that the meat slices are bonded to each other into a flat Flat;
[0028] 4) Dry th...
Embodiment 3
[0031] The preparation method of jerky is as follows:
[0032] Chopping and mixing: measure minced meat, salt, and compound phosphate according to the formula, then add functional protein peptides with a weight of 0.015‰ of the minced meat, and chop and mix for 10 minutes at a temperature of 9°C and a speed of 6000r / min to obtain minced meat;
[0033] Pickling: Add cooking wine, five-spice powder, sugar, glucose, transglutaminase, carrageenan, and konjac gum in the prescribed amount to the chopped minced meat, mix well, marinate at 5°C for 7 hours, take it out, and get marinated minced meat ;
[0034] Spreading sieve: first apply a layer of cooked vegetable oil on the sieve, and then spread the marinated meat slices on the sieve, the spreading sieve should be uniform, no gaps should be left between the meat slices, and no overlapping should be made to make the meat slices stick to each other and form a smooth surface flat plate;
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 
