Dried meat slice preparation method

A technology of jerky and minced meat, applied in protein-containing food ingredients, food science, etc., can solve the problems of color deterioration of meat products, unstable product flavor, excessive preservative dosage, etc., to improve tissue softness and product taste, Better texture and taste, and better quality

Inactive Publication Date: 2017-12-22
ZHEJIANG QINGLIAN FOOD
View PDF4 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, flavored dried meat is a dried meat product with a moisture content of about 20%, a protein content of 30%, and a fat content of about 10-20%, which causes it to be susceptible to bacterial contamination during production, storage, and transportation. A series of problems such as deterioration of product color and fat oxidation
At present, the main problems in the processing of jerky are: easy to be contaminated by microorganisms during storage, and the amount of preservatives exceeds the standard; loose texture, poor chewiness; unstable product color; high fat content, easy oxidation, unstable product flavor; processing technology lagging behind
However, the preparation method has a long preparation time period, and at the same time, nitrite is added, and the obtained jerky has certain hidden dangers, which is not easy to be accepted by consumers.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Dried meat slice preparation method

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0017] The preparation method of dried meat comprises chopping, pickling, spreading and sieving, drying and roasting, and the specific steps are as follows:

[0018] 1) Cutting and mixing: measure minced meat, salt, and compound phosphate according to the formula, then add functional protein peptides with a weight of 0.02‰ of the minced meat, and chop and mix for 8 minutes at a temperature of 6°C and a speed of 6500r / min to obtain chopped meat Meat mince, the amino acid sequence of the above functional protein peptide is TDHKKQDNAYASAIPRDMDRYSLYEENGFYTHCGPNFCCCIS, the functional protein peptide is positively charged, close to the cell membrane through electrostatic interaction, and then inserted into the outer membrane through hydrophobic interaction, resulting in the destruction of the outer membrane structure and increasing the permeability of the cell membrane Improve the breaking rate of chopping and mixing, so that the cytoplasm can be quickly dissociated. This step can qu...

Embodiment 2

[0024] The preparation method of jerky, its concrete steps are:

[0025] 1) Measure minced meat, salt, and compound phosphate according to the formula, then add functional protein peptides with a weight of 0.012‰ of minced meat, chop and mix for 12 minutes at a temperature of 12°C and a speed of 5500r / min to obtain minced meat. The amino acid sequence of the functional protein peptide is TDHKKQDNAYASAIPRDMDRYSLYEENGFYTHCGPNFCCCIS;

[0026] 2) Add cooking wine, five-spice powder, sugar, glucose, transglutaminase, carrageenan, and konjac gum in the prescribed amount to the minced meat, mix well, marinate at 3°C ​​for 8 hours, take it out, and then get cured minced meat;

[0027] 3) Apply a layer of cooked vegetable oil on the sieve first, and then spread the marinated meat slices on the sieve. The spread sieve should be uniform, and there should be no gaps or overlaps between the meat slices, so that the meat slices are bonded to each other into a flat Flat;

[0028] 4) Dry th...

Embodiment 3

[0031] The preparation method of jerky is as follows:

[0032] Chopping and mixing: measure minced meat, salt, and compound phosphate according to the formula, then add functional protein peptides with a weight of 0.015‰ of the minced meat, and chop and mix for 10 minutes at a temperature of 9°C and a speed of 6000r / min to obtain minced meat;

[0033] Pickling: Add cooking wine, five-spice powder, sugar, glucose, transglutaminase, carrageenan, and konjac gum in the prescribed amount to the chopped minced meat, mix well, marinate at 5°C for 7 hours, take it out, and get marinated minced meat ;

[0034] Spreading sieve: first apply a layer of cooked vegetable oil on the sieve, and then spread the marinated meat slices on the sieve, the spreading sieve should be uniform, no gaps should be left between the meat slices, and no overlapping should be made to make the meat slices stick to each other and form a smooth surface flat plate;

[0035] Drying and roasting: Dry the sieve tr...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a dried meat slice preparation method. The dried meat slice preparation method comprises chopping, curing, spreading and sieving, drying and baking, and particularly comprises the following steps: taking meat paste, salt and composite phosphate according to formula amounts, adding a functional protein peptide, and performing chopping to obtain chopped meat paste; adding cooking wine, five spice powder, white sugar, glucose, glutamine transaminase, carrageenan and konjac glucomannan into the chopped meat paste according to formula amounts, performing uniform mixing and curing, taking out to obtain cured meat paste; uniformly and consistently performing spreading and sieving; and drying a sieve plate, taking out semi-finished dried meat slice, and performing cooling, baking, press-cutting and packaging to obtain dried meat slice. The dried meat slice preparation method is simple and feasible and high in mechanical operation degree; the adopted meat paste can be either ground meat or leftovers, so that the raw material utilization ratio can be improved, and industrial large-scale production is easy; and by adoption of the preparation method, the dried meat slice is favorable in flavor, greasy feeling, tenderness, water-retaining property, elasticity and cohesiveness, long in storage and shelf life and improved in quality.

Description

technical field [0001] The invention relates to the field of food processing, in particular to a method for preparing dried meat. Background technique [0002] Dried meat has a long history. As early as in "Zhou Li", there are written records about dried meat. There is a saying in "Book of Rites" that "the cow repairs the dried deer". sentence. In the "Qi Min Yao Shu" of the Northern Wei Dynasty, there is a special chapter: "Preserved La", which introduces the production and varieties of dried meat. In the Southern and Northern Dynasties, there were five-flavored preserved, white preserved, sweet and crisp preserved. In the Tang Dynasty, there were Chimingxiang preserved and Hongqiu preserved. Dried meat is a cooked meat jerky food made of livestock and poultry meat as the main raw material, with seasoning and auxiliary materials, roasted and cooked. It has the characteristics of rich nutrition, easy to carry, and good taste. With the increase of people going out on vacat...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A23L13/60A23L13/10A23L13/20A23L13/40A23L13/70
CPCA23L13/67A23L13/10A23L13/20A23L13/428A23L13/72A23V2002/00A23V2250/55
Inventor陈军明韩祝君
OwnerZHEJIANG QINGLIAN FOOD