Unlock instant, AI-driven research and patent intelligence for your innovation.

Use of derived polypeptide series of pigment epithelium derived factors in ischemic myocardium protection

A technology for deriving factors and pigment epithelial cells, which can be used in growth factors/inducing factors, medical preparations containing active ingredients, specific peptides, etc. , endangering the quality of life and other problems, to achieve the effect of improving potency, low side effects, and significant effect

Pending Publication Date: 2018-01-19
董红燕
View PDF2 Cites 13 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, due to the short effective time window for recanalization of blocked coronary arteries, once the golden time window for recanalization of lesioned coronary arteries is delayed, conservative treatment is usually the only option, which will seriously affect the patient's survival, quality of life, and even life-threatening
[0004] Aiming at the problems of high morbidity and mortality of ischemic heart disease and the short time window of vascular recanalization treatment, the patent of the present invention provides a method that can inhibit chronic inflammation in coronary arteries and reduce the formation of atherosclerotic plaque; The immature microvascular structure tends to be stable, and then when myocardial infarction occurs, it can provide an alternative blood supply source for the ischemic area in time, and inhibit the enlarged interstitial edema in the pathological process, including collateral microcirculation vessels. The compression of all the blood vessels in the blood vessel, maintain the effective opening of the blood vessels, and then achieve the purpose of saving the ischemic myocardium; improve the microcirculation perfusion of the ischemic myocardium, prolong the time window of recanalization treatment, and prevent the occurrence of acute myocardial infarction; anti-ischemic myocardium Cell death, a series of peptides that protect the function of ischemic myocardium

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Use of derived polypeptide series of pigment epithelium derived factors in ischemic myocardium protection
  • Use of derived polypeptide series of pigment epithelium derived factors in ischemic myocardium protection
  • Use of derived polypeptide series of pigment epithelium derived factors in ischemic myocardium protection

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0077] 1.1 See the accompanying drawings in the manual figure 1 ,

[0078] By analyzing the amino acid arrangement and spatial structure of PEDF, the corresponding peptides that maintain blood vessel stability and inhibit cardiomyocyte apoptosis and necrosis were screened from the known functional peptides of PEDF that can bind to receptors in the heart, and these functions Through a series of experiments to verify their protective effect on ischemic myocardium, the best functional peptide or peptide combination that can replace PEDF can be obtained. The design screening process is divided into three steps:

[0079]Step 1: By integrating the previous research results on PEDF and analyzing and summarizing, the functional peptide corresponding to the PEDF receptor in the heart is screened out from the full-length PEDF. The screening results are as follows:

[0080] 34mer sequence (44-77aa): DPFFKVPVNKLAAAVSNFGYDLYRVRSSMSPTTN

[0081] 44mer sequence (78-121aa): VLLSPLSVATALSAL...

Embodiment 2

[0255] Biological effects of 34mer / 44mer and 34mer+44mer derived from PEDF in myocardial tissue

[0256] Coronary atherosclerosis is the main pathological factor inducing cardiac ischemic infarction, and the inflammation of coronary artery endothelium is an important factor in the formation of atherosclerotic plate. Studies have found that the formation of atherosclerotic plaques is related to the production and release of inflammatory factors by damaged endothelial cells, which inhibit the production of IL-1β and TNF-α by damaged endothelial cells

[0257] The human heart is an organ that functions efficiently but has a poor ability to repair itself. Within 24 hours of myocardial infarction (AMI), a large number of myocardial cells die, and then the necrotic myocardial fibers gradually dissolve to form myolytic lesions. Cardiomyocyte death exists even for a considerable period of time after AMI, even for a lifetime. The main pathogenic mechanism of heart failure after myoca...

Embodiment 3

[0261] The use method and advantages of the series of PEDF source functional peptides:

[0262] Instructions:

[0263] 34-mer and 44-mer, as related functional peptides of PEDF, play different biological roles through their respective targets. According to the biological effects of 34-mer and 44-mer related functional peptides, for patients with high risk factors of cardiovascular disease, 34mer preparations can be used alone to prevent the occurrence of ischemic heart disease; for patients with early acute myocardial infarction, 34mer+44mer composite preparations can be used; and only 44mer preparations are used for those whose myocardial infarction enters the chronic phase.

[0264] The present invention proposes different pathological states and different time windows of acute (chronic) myocardial ischemia and impaired cardiac function, and according to the time-lesion-dependent characteristics of ischemic myocardium, different PEDF source polypeptides are applied, and tim...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a use of a derived polypeptide series of pigment epithelium derived factors in ischemic myocardium protection. The polypeptide is derived from the pigment epithelium derived factors, and every amino acid sequence in the polypeptide includes at least eighteen continuous amino acid residues. The PEDF derived functional peptide has good function advantages, and has remarkablecardiac muscle tissue capillary tube stabilization, vascular leakage prevention, myocardial cell protection and cardiac muscle tissue inflammation prevention effects.

Description

technical field [0001] The invention belongs to the technical field of biomedicine and relates to a derivative polypeptide of pigment epithelium-derived factor, in particular to a polypeptide used in medicine to protect ischemic myocardium. In addition, the present invention also relates to a method for preparing a pharmaceutical composition and protecting ischemic myocardium by using the series of polypeptides. Background technique [0002] At present, there are patents for the application of pigment epithelium derived factor (PEDF) source polypeptides, and the main protective functions involve: inhibiting and / or improving skin aging, treating angioproliferative eye diseases, treating osteoarthritis, alopecia and / or hair loss Fading, inhibiting tumor angiogenesis, treating liver cirrhosis, promoting stem cell proliferation and wound healing, etc. [0003] The main means and goals of the current prevention and treatment of ischemic heart disease (ischemic heart disease, IHD...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/475A61K38/17A61P9/10
Inventor 董红燕张中明刘志伟张昊苗浩然刘修成
Owner 董红燕