Cell BHK/slam based on small ruminant animal disease virus receptor
A PPR, cell technology, applied in the field of biology, can solve the problems of difficult adaptation of the virus, undetectable virus, low cytotoxicity of the virus, etc., and achieves the effect of convenient and fast spin column, improved cloning efficiency and good stability
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0041] 1. Design, synthesize and clone vector pDONRTM221 P5-P2 and expression vector pLenti4 / V5-DEST according to the characteristics of the complete ORF post-translational protein sequence (SEQ ID NO.1) of Peste des petits ruminants virus Slam receptor TM Vector matching primers SEQ ID NO.2 and SEQ ID NO.3, the three sequences are as follows:
[0042] SEQ ID NO.1: MDHKGLLSSNVLLFFSLIIELSCRTGEGLTSSTK
[0043] TIRGQLGSSVLLPLASEEISRSMNKSIHILVTMAESPRDTVKKKIVSLDLRKGDSPRLEDGYEFHLENLSLRIL KSRKEDEGWYFISLEENVSVQHFSLQLKLYEQVSTPQIKVLNSTQEDGNCSLMLACVVEKGDHVTYNWSEEAGA PLLSPTNSSHLLYLTLGPQRANNVYICIASNPISNSSQTFIPWSRCSSRPPESRQWGLYTGLFLGGIVGVIMIL QVVILLLRRRGKTDNYQPTMEAKSLTIYAQVQKSGSVKKRPDPLPAQDPCTTIYVAATEPVPEPIQESGSFTVY ASVTVPES;
[0044] SEQ ID NO. 2: GGGGACAAGTTTGTACAAAAAAGCAGGCTTAATGGATCACAAAGGGCTCCTCTCCT;
[0045] SEQ ID NO. 3: GGGGACCACTTTGTACAAGAAAGCTGGGTTT
[0046] CAGCTCCTCTGGAACCGTCACA.
[0047] 2. Preparation of total RNA related to the receptor of Peste des petits ruminants viru...
Embodiment 2
[0065] Steps 1-5 are the same as in Example 1.
[0066] 6. Co-transfect 293-FT cells with expression backbone and helper plasmid to obtain replication-defective lentivirus-like particles
[0067] As above, the three auxiliary plasmids pLP1, pLP2, and VSV-G were extracted in large quantities with the endotoxin-free large-scale plasmid extraction kit, and 12ug of the expression backbone, pLP1, pLP2, and VSV-G were added to 750ul opti-MEM, and another 750ulopti-MEM was added. Add 30 ul of p3000 to MEM, and transfect 293-FT cells in sequence according to the instructions of liposome 3000; replace the complete medium 8 hours after transfection, and collect the supernatant of 293-FT cells aseptically for 48 hours. Centrifuge at 5000 rpm at 4°C for 5 minutes, discard the cell debris and precipitate, and the collected supernatant is the replication-defective lentivirus-like particles with the complete ORF of Peste des petits ruminant virus Slam receptors, which are stored in a -70°C r...
Embodiment 3
[0074] 1-7 steps are with embodiment 1.
[0075] 8. BHK / slam cells express the complete ORF of slam and its activity analysis
[0076] Select the BHK and BHK / slam cells in good growth state, digest the normal cells with trypsin, discard the trypsin, collect the cells in the maintenance solution, freeze and thaw repeatedly in the refrigerator, add 500ul RIPA cell lysate (Solabu), Pipet several times with a gun to make the lysate fully contact with the cells. After lysing, centrifuge at 12000rpm for 5min, add 4x sample buffer to the supernatant, boil for 10min, and load the sample for sodium dodecylsulfonate polyacrylamide gel electrophoresis ( 12% SDS-PAGE), the protein glue utilizes BIO-RAD company electroporation instrument (Trans- Turbo) was transferred to a PVDF (polyvinylidene double oxide membrane) transfer membrane, transferred for 7 minutes, washed with PBS 5 times, shaken for 5 minutes each time, and TBST containing 5% skimmed milk powder was added dropwise to block...
PUM
Property | Measurement | Unit |
---|---|---|
The average diameter | aaaaa | aaaaa |
The average diameter | aaaaa | aaaaa |
Copy number | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com