Hp tetravalent antigen as well as preparation method and application thereof
A technology of antigen and egg yolk antibody, applied in the field of biomedicine, can solve the problems of poor purity, low neutralizing activity, and poor effect of egg yolk antibody
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0051] Embodiment 1: a kind of Hp tetravalent antigen, it is urease element (UreB), vacuolar cytotoxin (VacA), cytotoxin gene A (CagA) and Hp flagellin sheath protein (HpaA) four kinds of antigen proteins After the corresponding nucleotides are optimized, they are cloned into pET28a, pET30 or pColdII prokaryotic expression vectors, and the antigens are expressed by prokaryotic expression bacteria BL21, Rosetta or OrigamiB;
[0052] The protein sequence 1 corresponding to the urease element (UreB) is:
[0053] MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEE LDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAG GIDTHIHFISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSMNLGFLAK GNASNDASLADQIEAGAIGFKIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMA AIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIK EDVQFADSRIRPQTIAAEDTLHDMGIFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKG DNDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGD ANASIPTPQP...
Embodiment 2
[0063] Embodiment 2: The preparation method of Hp tetravalent antigen comprises the following steps:
[0064] (11) Prokaryotic bacterial culture: Streak inoculation of prokaryotic expression bacteria BL21, Rosetta or OrigamiB on LB culture plate, and put in 37°C incubator overnight. On the second day, pick a single colony and culture it overnight in LB medium at 37°C, 250rpm shaker; on the third day, inoculate the overnight cultured bacterial solution into fresh LB medium at 37°C, 4000 Rpm culture 1.5h to OD600 to 0.6. Transfer the bacterial culture solution into a centrifuge tube, place it on ice for 10 minutes, and centrifuge at 4000 rpm at 4°C for 10 minutes; discard the supernatant and replace it with pre-cooled 0.05M CaCl 2 Gently resuspend the cells in the solution, place on ice for 30 minutes, centrifuge at 4000rpm at 4°C for 10 minutes; discard the supernatant, add pre-cooled 0.05M CaCl containing 15% glycerol 2 solution, resuspended cells, placed on ice, aliquoted i...
Embodiment 3
[0068] Embodiment 3: the preparation method of the egg that contains the yolk antibody of Hp tetravalent antigen, comprises the following steps:
[0069] (21) emulsifying the Hp tetravalent antigen obtained through genetic engineering with an adjuvant; the adjuvant is Freund's complete adjuvant;
[0070] (22) Immune laying hens: select healthy laying hens aged 10 to 40 weeks and raise them in isolation for subcutaneous injection. Each hen is injected with 2-6 injection points. The amount of antigen used for immunization is 100 μg / chicken. The first immunization After that, booster immunization every two weeks;
[0071] (23) Collect the eggs produced by the last immunization, that is, obtain the eggs containing the egg yolk antibody of Hp tetravalent antigen.
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



