252 results about "Flagellin" patented technology

The present invention relates to Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in modulating the inflammation of a tissue or an organ in a subject.

Fusion proteins and DNA conjugates are disclosed which contain a TLR/CD40/agonist and optional antigen combination. The use of these protein and DNA conjugates as immune adjuvants and as vaccines for treatment of various chronic diseases such as HIV infection is also provided.

The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided.

Compositions comprise a flagellin component or a Toll-like Receptor agonist component that is at least a portion of a flagellin or a Toll-like Receptor agonist, wherein the flagellin component or Toll-like Receptor agonist component includes at least one cysteine residue and whereby the flagellin component or Toll-like Receptor agonist component activates a Toll-like Receptor 5 or Toll-like Receptor. Compositions comprise a flagellin component that is at least a portion of a flagellin, wherein at least one lysine of the flagellin component has been substituted with at least one arginine, serine and histidine, whereby the flagellin component activates Toll-like Receptor 5. Compositions can further include an antigen, such as an influenza antigen, a flavivirus antigen, a pathogen-related antigen, a bacterial capsular antigen and a carrier protein. The compositions are used to stimulate an immune response and a protective immune response in a subject.

A human synthetic peptide-based influenza vaccine for intranasal administration comprises a mixture of flagella containing at least four epitopes of influenza virus reactive with human cells, each expressed individually in Salmonella flagellin, said influenza virus epitopes being selected from the group consisting of: (i) one B-cell hemagglutinin (HA) epitope; (ii) one T-helper hemagglutinin (HA) or nucleo-protein (NP) epitope that can bind to many HLA molecules; and (iii) at least two cytotoxic lymphocyte (CTL) nucleoprotein (NP) or matrix protein (M) epitopes that are restricted to the most prevalent HLA molecules in different human populations.

The use of flagellin and flagellin related polypeptides for the protection of mammals from the effects of apoptosis is described.

The use of flagellin and flagellin related polypeptides for reducing cancer treatment side effects in mammals is described.

Compositions comprise at least a portion of an antigen and at least a portion of a flagellin that lacks a hinge region. Compositions, fusion proteins and polypeptides comprise at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein. The viral protein of the compositions, fusion proteins and polypeptides of the invention are flaviviral proteins, including a West Nile flaviviral protein, a Dengue flaviviral protein, a Langat flaviviral protein, a Kunjin flaviviral protein, a Murray Valley encephalitis flaviviral protein, a Japanese encephalitis flaviviral protein, a Tick-borne encephalitis flaviviral protein, a Yellow fever flaviviral protein and a hepatitis C flaviviral protein. The compositions, fusion proteins and polypeptides are used to stimulate an immune response and protective immunity in a subject.

The invention discloses a bacillus licheniformis host bacterium BL10 with multiple gene deletion, the accession number of which is CCTCCNO:M2013400. The host bacterium derives from a bacillus licheniformis WX-02 which partially or completely has deletion of ten genes. The ten genes comprises eight protease genes (mpr encoding a metalloprotease; vpr encoding a serine protease; aprX encoding an intracellular serine protease; epr encoding a minimal extracellular protease; bpr encoding a bacillus peptidase F; wprA encoding a protease combined with cell walls; aprE encoding an extracellular alkaline serine protease; and bprA encoding a bacillus peptidase F) and two extracellular secretory protein genes (hag encoding flagellin; and amyL encoding alpha-amylase). The BL10 has completely no extracellular protease activity and can reduce the degradation effect of a protease on a target protein. When the target protein is expressed by the expression host, the expression level is higher, and the host bacterium benefits protein expression enhancement.

The invention discloses a vibrio parahaemolyticus flagellin monoclonal antibody and an antigen capture ELISA (enzyme-linked immunosorbent assay) kit. The vibrio parahaemolyticus flagellin monoclonal antibody is produced by secreting of a hybridoma cell strain with the preservation number of CGMCC (China General Microbiological Culture Collection) No.6061. The vibrio parahaemolyticus flagellin monoclonal antibody can be used for detecting vibrio parahaemolyticus. The invention also discloses a vibrio parahaemolyticus flagellin capture ELISA (enzyme-linked immunosorbent assay) kit.

Methods are disclosed for diagnosing inflammatory bowel disease (IBD), one exemplar method of which includes determining whether a sample is positive for anti-flagellin antibodies (AFA), diagnosing the presence of IBD when the sample is positive for AFA, and diagnosing the absence of IBD when the sample is negative for AFA. Alternatively, instead of testing for positivity with respect to AFA, or in addition thereto, an exemplar method can determine whether the sample has an AFA level above an AFA cut-off value (X); and diagnosing IBD when the AFA level is above X, and diagnosing absence of IBD when the AFA level is below X. Test kits that include items used to carry out the disclosed methods are also disclosed.

Compositions that include at least one fusion protein that includes at least a portion of at least one flagellin and at least a portion of at least one malaria antigen can be employed in methods that stimulate an immune response in a subject, in particular, sterile immunity and a protective immune response in a subject.

The present invention provides a vaccine composition for dental caries caused by S. mutans infection, where the vaccine composition comprises an antigen derived from a surface protein PAc of S. mutans and an adjuvant derived from flagellin. The present invention further provides methods for preparing the vaccine composition. The present invention also provides methods for preventing or curing dental caries caused by S. mutans by administrating to a subject the vaccine composition.

Improved antibodies are provided selected from human, dual-specific, chimeric or humanized antibodies, wherein said human chimeric and humanized antibodies specifically bind to flagellin type A or type B of P. aeruginosa, and said dual-specific antibodies specifically binds to flagella type A and type B of Pseudomonas aeruginosa, and said antibodies are protective against infection caused by P. aeruginosa. These antibodies as well as pharmaceutical composition comprising them are useful for the treatment of indications caused by P. aeruginosa infection.

The invention relates to a vaccine reagent kit for preventing decayed tooth, which comprises antigen and adjuvant, wherein the antigen is a dna recombinant plasmid of at least one surface proteantigen and at least one glucosyltransferase which co-express decayed tooth streptococcus mutans; and the adjuvant is flagellins of one or more than one germ. The vaccine reagent kit for preventing the decayed tooth has strong immunogenicity, can excite comprehensive and lasting immune response, and has strong specificity, even immune effect and simple and convenient operation. The invention also provides an application method for the vaccine reagent kit for preventing the decayed tooth, and the vaccine reagent kit has good immune effect and simple and convenient operation.

The present invention is directed to flagellin and its use as an adjuvant for vaccination. The invention can be used in vaccine formulations to improve immunity against any other antigen administered at the same localization. The antigen can be administered in the same construct as Flagellin or in any other formulation given at the same localization. As an alternative flagellin can be used to stimulate immunity against antigens expressed at a specific location. Flagellin can also be used to induce local inflammation with the purpose of creating a model for inflammation.