Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

257 results about "Flagellin" patented technology

Flagellin is a globular protein that arranges itself in a hollow cylinder to form the filament in a bacterial flagellum. It has a mass of about 30,000 to 60,000 daltons. Flagellin is the principal component of bacterial flagellum, and is present in large amounts on nearly all flagellated bacteria.

Polypeptide and immune modulation

The present invention relates to Roseburia flagellin, and / or a polynucleotide sequence encoding said Roseburia flagellin, and / or a vector comprising said polynucleotide sequence, and / or a host cell, including bacteria, comprising said vector, and / or a host cell, including bacteria, comprising said polynucleotide sequence, for use in modulating the inflammation of a tissue or an organ in a subject.
Owner:4D PHARMA RES LTD +1

Tlr agonist (flagellin)/cd40 agonist/antigen protein and DNA conjugates and use thereof for inducing synergistic enhancement in immunity

InactiveUS20090004194A1Improve immunityEnhance cellular immune responseAntibacterial agentsFungiDiseaseTlr agonists
Fusion proteins and DNA conjugates are disclosed which contain a TLR / CD40 / agonist and optional antigen combination. The use of these protein and DNA conjugates as immune adjuvants and as vaccines for treatment of various chronic diseases such as HIV infection is also provided.
Owner:UNIV OF COLORADO THE REGENTS OF

Toll-like receptor 5 ligands and methods of use

The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided.
Owner:INSTITUTE FOR SYSTEMS BIOLOGY

Polypeptide and immune modulation

ActiveUS9796762B2Promotes digestive healthNervous disorderPeptide/protein ingredientsNucleotideRoseburia
The present invention relates to Roseburia flagellin, and / or a polynucleotide sequence encoding said Roseburia flagellin, and / or a vector comprising said polynucleotide sequence, and / or a host cell, including bacteria, comprising said vector, and / or a host cell, including bacteria, comprising said polynucleotide sequence, for use in modulating the inflammation of a tissue or an organ in a subject.
Owner:4D PHARMA RES LTD +1

Compositions that include hemagglutinin, methods of making and methods of use thereof

Compositions comprise a flagellin component or a Toll-like Receptor agonist component that is at least a portion of a flagellin or a Toll-like Receptor agonist, wherein the flagellin component or Toll-like Receptor agonist component includes at least one cysteine residue and whereby the flagellin component or Toll-like Receptor agonist component activates a Toll-like Receptor 5 or Toll-like Receptor. Compositions comprise a flagellin component that is at least a portion of a flagellin, wherein at least one lysine of the flagellin component has been substituted with at least one arginine, serine and histidine, whereby the flagellin component activates Toll-like Receptor 5. Compositions can further include an antigen, such as an influenza antigen, a flavivirus antigen, a pathogen-related antigen, a bacterial capsular antigen and a carrier protein. The compositions are used to stimulate an immune response and a protective immune response in a subject.
Owner:VAXINNATE

Peptide-based vaccine for influenza

A human synthetic peptide-based influenza vaccine for intranasal administration comprises a mixture of flagella containing at least four epitopes of influenza virus reactive with human cells, each expressed individually in Salmonella flagellin, said influenza virus epitopes being selected from the group consisting of: (i) one B-cell hemagglutinin (HA) epitope; (ii) one T-helper hemagglutinin (HA) or nucleo-protein (NP) epitope that can bind to many HLA molecules; and (iii) at least two cytotoxic lymphocyte (CTL) nucleoprotein (NP) or matrix protein (M) epitopes that are restricted to the most prevalent HLA molecules in different human populations.
Owner:YEDA RES & DEV CO LTD

Flagellin Related Polypeptides and Uses Thereof

The use of flagellin and flagellin related polypeptides for the protection of mammals from the effects of apoptosis is described.
Owner:THE CLEVELAND CLINIC FOUND

Use Of Flagellin In The Immunotherapy Of Yersinia Pestis

InactiveUS20080124361A1Antibacterial agentsAntibody mimetics/scaffoldsAntigenYersinia pestis antigen
The invention provides a fusion protein comprising a flagellin adjuvant and a Yersinia pestis antigen. Also provided are compositions comprising a flagellin adjuvant and a Yersinia pestis antigen. The invention also discloses methods of making a fusion protein comprising a flagellin adjuvant and a Yersinia pestis antigen. The invention further provides pharmaceutical formulations and methods for inducing an immune response against Yersinia pestis.
Owner:WAKE FOREST UNIV HEALTH SCI INC

Tlr agonist (flagellin)/cd40 agonist/antigen protein and DNA conjugates and use thereof for inducing synergistic enhancement in immunity

Fusion proteins and DNA conjugates are disclosed which contain a TLR / CD40 / agonist and optional antigen combination. The use of these protein and DNA conjugates as immune adjuvants and as vaccines for treatment of various chronic diseases such as HIV infection is also provided.
Owner:KEDL ROSS

Flagellin polypeptide vaccines

Vaccines that comprise or generate immunomodulatory flagellin polypeptides able to stimulate an innate immune response intracellularly and extracellularly employ viruses, bacteria or parasitic cells that contain expression systems for such polypeptides, as well as fusion proteins that contain antigens and / or cell penetrating peptides along with the immunomodulatory peptide.
Owner:INSTITUTE FOR SYSTEMS BIOLOGY

Compositions comprising pathogen-associated molecular patterns and antigens and methods of use thereof

Compositions comprise at least a portion of an antigen and at least a portion of a flagellin that lacks a hinge region. Compositions, fusion proteins and polypeptides comprise at least a portion of at least one pathogen-associated molecular pattern and at least a portion of at least one viral protein. The viral protein of the compositions, fusion proteins and polypeptides of the invention are flaviviral proteins, including a West Nile flaviviral protein, a Dengue flaviviral protein, a Langat flaviviral protein, a Kunjin flaviviral protein, a Murray Valley encephalitis flaviviral protein, a Japanese encephalitis flaviviral protein, a Tick-borne encephalitis flaviviral protein, a Yellow fever flaviviral protein and a hepatitis C flaviviral protein. The compositions, fusion proteins and polypeptides are used to stimulate an immune response and protective immunity in a subject.
Owner:VAXINNATE

Flagellin related polypeptides and uses thereof

The use of flagellin and flagellin related polypeptides for the protection of mammals from the effects of apoptosis is described.
Owner:THE CLEVELAND CLINIC FOUND

Use of Flagellin in Tumor Immunotherapy

The invention provides a fusion protein comprising a flagellin adjuvant and a tumor antigen. Also provided are compositions comprising a flagellin adjuvant and a tumor antigen. The invention further provides pharmaceutical formulations and methods for inducing an immune response against a tumor antigen and methods of treating a tumor in a subject.
Owner:WAKE FOREST UNIV HEALTH SCI INC

Method for reducing the effects of chemotherapy using flagellin related polypeptides

InactiveUS8580321B2Eliminate side effectsReducing cisplatin-associated toxicityBiocideNervous disorderSide effectOncology
The use of flagellin and flagellin related polypeptides for reducing cancer treatment side effects in mammals is described.
Owner:THE CLEVELAND CLINIC FOUND

Bacillus licheniformis expression host

The invention discloses a bacillus licheniformis host bacterium BL10 with multiple gene deletion, the accession number of which is CCTCCNO:M2013400. The host bacterium derives from a bacillus licheniformis WX-02 which partially or completely has deletion of ten genes. The ten genes comprises eight protease genes (mpr encoding a metalloprotease; vpr encoding a serine protease; aprX encoding an intracellular serine protease; epr encoding a minimal extracellular protease; bpr encoding a bacillus peptidase F; wprA encoding a protease combined with cell walls; aprE encoding an extracellular alkaline serine protease; and bprA encoding a bacillus peptidase F) and two extracellular secretory protein genes (hag encoding flagellin; and amyL encoding alpha-amylase). The BL10 has completely no extracellular protease activity and can reduce the degradation effect of a protease on a target protein. When the target protein is expressed by the expression host, the expression level is higher, and the host bacterium benefits protein expression enhancement.
Owner:HUAZHONG AGRI UNIV

Deletion mutants of flagellin and methods of use

Compositions that include Toll-like Receptor 5 agonists and at least a portion of at least one viral antigen can be employed in methods that stimulate an immune response in a subject, in particular, a protective immune response in a subject. Compositions can be associated with particles and employed in the methods in relatively low doses to provide protective immunity to viral infection.
Owner:VAXINNATE

Compositions of flagellin and papillomavirus antigens

Compositions that include at least one protein that activates a Toll-like Receptor and includes at least a portion of at least one Toll-like Receptor agonist and at least a portion of at least one papillomavirus suppressor binding protein, papillomavirus transforming protein and papillomavirus capsid protein can be employed in methods that stimulate an immune response in a subject, in particular, a protective immune response in a subject. Compositions can further include an adjuvant and a carrier protein.
Owner:VAXINNATE

Vibrio parahaemolyticus flagellin monoclonal antibody and antigen capture ELISA (enzyme-linked immunosorbent assay) kit

The invention discloses a vibrio parahaemolyticus flagellin monoclonal antibody and an antigen capture ELISA (enzyme-linked immunosorbent assay) kit. The vibrio parahaemolyticus flagellin monoclonal antibody is produced by secreting of a hybridoma cell strain with the preservation number of CGMCC (China General Microbiological Culture Collection) No.6061. The vibrio parahaemolyticus flagellin monoclonal antibody can be used for detecting vibrio parahaemolyticus. The invention also discloses a vibrio parahaemolyticus flagellin capture ELISA (enzyme-linked immunosorbent assay) kit.
Owner:BEIJING ENTRY EXIT INSPECTION & QUARANTINE BUREAU INSPECTION & QUARANTINE TECH CENT

Diagnostic Tests and Methods for Diagnosing Inflammatory Bowel Disease

Methods are disclosed for diagnosing inflammatory bowel disease (IBD), one exemplar method of which includes determining whether a sample is positive for anti-flagellin antibodies (AFA), diagnosing the presence of IBD when the sample is positive for AFA, and diagnosing the absence of IBD when the sample is negative for AFA. Alternatively, instead of testing for positivity with respect to AFA, or in addition thereto, an exemplar method can determine whether the sample has an AFA level above an AFA cut-off value (X); and diagnosing IBD when the AFA level is above X, and diagnosing absence of IBD when the AFA level is below X. Test kits that include items used to carry out the disclosed methods are also disclosed.
Owner:GEWIRTZ ANDREW +2

Antibodies against flagellin and uses thereof

The present invention provides a novel class of monoclonal antibodies which have a high affinity, broad spectrum neutralizing reactivity to flagellin from various Gram-negative bacteria including, but not limited to, E. coli, Salmonella, Serratia, Proteus, Enterobacter, Citrobacter, Campylobacter and Pseudomonas. The present invention further provides methods of treating infections and diseases using anti-flagellin antibodies in humans, other animals and birds.
Owner:INOTECK PHARMA CORP

Combinant polypeptide for use in the manufacture of vaccines against Campylobacter induced diarrhea and to reduce colonization

This invention comprises a recombinant protein comprising the maltose binding protein (MBP) of Escherichia coli fused to amino acids 5–337 of the FlaA flagellin of Campylobacter coli VC167 which has provided evidence of immunogenicity and protective efficacy against challenge by a heterologous strain of campylobacter, Campylobacter jejuni 81–176 in mammals. The invention further comprises a recombinant DNA construct encoding the immunodominant region (region I through III) of flagellin from Campylobacter spp. for use as a component of a vaccine against Campylobacter diarrhea. The invention therefore represents an effective treatment against Campylobacter but avoids inducing the autoimmune Guillain Barre Syndrome (GBS), a post-infection polyneuropathy caused by Campylobacter molecular mimicry of human gangliosides which has hampered the development of vaccines heretofore.
Owner:THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY OF THE NAVY

Diagnostic test for borrelia infection

Bites from Amblyomma americanum, a hard tick, have been associated with a Lyme disease-like illness in the southeastern and south-central United States. Present in 2% of ticks collected in four states were uncultivable spirochetes. Through use of the polymerase chain reaction, partial sequences of the flagellin and 16s rRNA genes of microorganisms from Texas and New Jersey were obtained. The sequences showed that the spirochete was a Borrelia sp. but distinct from other known members of this genus, including B. burgdorferi, the agent of Lyme disease. Species-specific differences in the sequences of the flagellin protein, the flagellin gene and the 16s rRNA gene between the new Borrelia species and previously known species provide compositions and methods for assay for determining the presence of this new spirochete, or for providing evidence of past or present infection by this spirochete in animal reservoirs and humans.
Owner:BOARD OF RGT THE UNIV OF TEXAS SYST

Carious tooth vaccine and preparation method

The present invention provides a vaccine composition for dental caries caused by S. mutans infection, where the vaccine composition comprises an antigen derived from a surface protein PAc of S. mutans and an adjuvant derived from flagellin. The present invention further provides methods for preparing the vaccine composition. The present invention also provides methods for preventing or curing dental caries caused by S. mutans by administrating to a subject the vaccine composition.
Owner:WUHAN INST OF VIROLOGY CHINESE ACADEMY OF SCI

Therapeutic antibodies against flagellated pseudomonas aeruginosa

Improved antibodies are provided selected from human, dual-specific, chimeric or humanized antibodies, wherein said human chimeric and humanized antibodies specifically bind to flagellin type A or type B of P. aeruginosa, and said dual-specific antibodies specifically binds to flagella type A and type B of Pseudomonas aeruginosa, and said antibodies are protective against infection caused by P. aeruginosa. These antibodies as well as pharmaceutical composition comprising them are useful for the treatment of indications caused by P. aeruginosa infection.
Owner:LOSTAM BIOPHARMLS

Vaccine reagent kit for preventing carious tooth and method of use thereof

InactiveCN101411872AImproving immunogenicityComprehensive persistent immune responseBacterial antigen ingredientsDigestive systemAdjuvantA-DNA
The invention relates to a vaccine reagent kit for preventing decayed tooth, which comprises antigen and adjuvant, wherein the antigen is a dna recombinant plasmid of at least one surface proteantigen and at least one glucosyltransferase which co-express decayed tooth streptococcus mutans; and the adjuvant is flagellins of one or more than one germ. The vaccine reagent kit for preventing the decayed tooth has strong immunogenicity, can excite comprehensive and lasting immune response, and has strong specificity, even immune effect and simple and convenient operation. The invention also provides an application method for the vaccine reagent kit for preventing the decayed tooth, and the vaccine reagent kit has good immune effect and simple and convenient operation.
Owner:WUHAN INST OF VIROLOGY CHINESE ACADEMY OF SCI

Use of Flagellin as an Adjuvant for Vaccine

The present invention is directed to flagellin and its use as an adjuvant for vaccination. The invention can be used in vaccine formulations to improve immunity against any other antigen administered at the same localization. The antigen can be administered in the same construct as Flagellin or in any other formulation given at the same localization. As an alternative flagellin can be used to stimulate immunity against antigens expressed at a specific location. Flagellin can also be used to induce local inflammation with the purpose of creating a model for inflammation.
Owner:LJUNGGREN HANS GUSTAF +4

Methods and Compositions for Providing Protective Immunity in the Elderly

Compositions that include a flagellin / antigen protein comprising at least a portion of at least one flagellin and at least a portion of at least one antigen and methods of administering these compositions to humans at least 49 years old. The compositions stimulate immune response to the antigen, in particular, a protective immune response to the antigen, in the human, such as an elderly human.
Owner:VAXINNATE
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More