Patents
Literature
PatSnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

43 results about "TLR5" patented technology

Toll-like receptor 5, also known as TLR5, is a protein which in humans is encoded by the TLR5 gene. It is a member of the toll-like receptor (TLR) family. TLR5 is known to recognize bacterial flagellin from invading mobile bacteria. It has been shown to be involved in the onset of many diseases, which includes Inflammatory bowel disease. Recent studies have also shown that malfunctioning of TLR5 is likely related to osteoclastogenesis and bone loss. Abnormal TLR5 functioning is related to the onset of gastric, cervical, endometrial and ovarian cancers.

Toll-like receptor 5 ligands and methods of use

The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided.
Owner:INSTITUTE FOR SYSTEMS BIOLOGY

RNAi-based therapeutics for allergic rhinitis and asthma

The present invention provides compositions comprising one or more RNAi agents (e.g., siRNAs, shRNAs, or RNAi vectors) for the treatment of conditions and diseases mediated by (e.g., featuring IgE-mediated hypersensitivity), as well as systems for identifying RNAi agents effective for this purpose. The compositions are suitable for the treatment of allergic rhinitis and / or asthma. In certain embodiments of the invention the RNAi agent is targeted to a transcript that encodes a protein selected from the group consisisting of the FCεRIα chain, the FCεRIβ chain, c-Kit, Lyn, Syk, ICOS, OX40L, CD40, CD80, CD86, Re1A, Re1B, 4-1BB ligand, TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, CD83, SLAM, common γ chain, and COX-2. In addition, the invention provides RNAi agent / delivery agent compositions and methods of use. In certain embodiments of the invention compositions comprising an RNAi agent are delivered by the respiratory route.
Owner:MASSACHUSETTS INST OF TECH

Compositions of pamps and Listeria monocytogenes and methods of use

InactiveUS20090081725A1Antibacterial agentsAntibody mimetics/scaffoldsAntigenPathogen-Associated Molecular Pattern Molecules
A composition comprising a pathogen associated molecular pattern (PAMP) protein that activates toll-like receptor 2 (TLR2) or toll-like receptor 5 (TLR5) signaling and at least two distinct antigens of Listeria monocytogenes. Amino acids, nucleotides, vectors, cell lines, and the methods for production and use of the compositions are provided.
Owner:VAXINNATE +1

Method for in-vitro amplification of CD8+T cell and cell subset of CD8+T cell

The invention establishes a method for in-vitro amplification of a CD8+T cell and a cell subset of the CD8+T cell. By adding a TLR1 / 2 agonist, a TLR2 / 6 agonist and a TLR5 agonist into an in-vitro culture system for conventionally culturing and amplifying the CD8+T cell or conjunctively utilizing the agonists, the amplification efficiency of the CD8+T cell can be remarkably improved; besides, by utilizing a TLC agonist, the functional CD8+T cell subsets which are difficult to amplify under a conventional culture condition are amplified, such as PD-1+CD8+T cells and TEM CD8+T cells; and the CD8+T cells and the functional cell subsets can be rapidly and largely propagated under the common and continuous stimulation of a TLRs agonist, recombinant cell factors IL-2, IL-7 and IL-15, an anti-human CD3 antibody and anti-human CD28 antibody coated magnetic beads.
Owner:SHANGHAI INNOVATIONAL CHANGAN BIOLOGICAL TECH CO LTD

Blockade of eosinophil production by toll-like receptors

It has long been known that eosinopenia is observed during acute bacterial infection yet the mechanism remains undefined. Herein, we investigated the consequence of exposure to microbial products, specfically bacterial lipopolysaccharide (LPS), on eosinophil production. We demonstrate that developing murine eosinophils transiently express mRNA for six Toll-like receptors (TLR5) with highest expression of TLR2 and TLR4 throughout eosinophil development and nearly undetectable levels on mature eosinophils. LPS stimulation of eosinophil progenitors ex vivo markedly inhibited IL-5- mediated cellular proliferation and expansion Further LPS adrninistratwn in vivo reduced numbers of eosinophil progenitors in the bone marrow and blood in mice. Notably, LPS effectively reduced eosinophilia even in hypereosinophilic mice induced by the IL-S transgene. Taken together, these findings identify a mechanistic explanation for eosinopenia following bacterial infections and a novel therapeutic strategy for depleting eosinophil progenitors and inhibiting peripheral eosinophilia in eosinophil associated diseases.
Owner:CHILDRENS HOSPITAL MEDICAL CENT CINCINNATI

Mesenchymal stem cell for inhibiting tumor growth and preparation method and application

ActiveCN108715832ATumor suppressor activityEnhance killing activity in vitroGenetically modified cellsUnknown materialsSerum free mediaMesenchymal stem cell
The invention discloses a mesenchymal stem cell for inhibiting tumor growth and a preparation method and an application, and relates to the technical field of the medicine. The provided mesenchymal stem cell for inhibiting the tumor growth is a TLR5 positive mesenchymal stem cell. The preparation method for the TLR5 positive mesenchymal stem cell is to separate TLR5 high-expression positive mesenchymal stem cells by using a flow-type or overexpress TLR5 on the mesenchymal stem cell. The invention further provides a cultural supernatant containing a serum-free medium and the TLR5 positive mesenchymal stem cell, and further provides applications of the TLR5 positive mesenchymal stem cell and the cultural supernatant for preparing an anti-tumor drug. The cultural supernatant in TLR5+MSC conditions has the remarkable inhibiting effects to the in-vitro proliferation, the migration and the clonality of a tumor cell. The TLR5-activated MSC is capable of remarkably improving the in-vitro killing activity of a NK cell. The TLR5-activated MSC is capable of inhibiting the tumor growth in Lewis lung cancer mice.
Owner:北京华奥玄德生物医药科技有限公司

Modified flagellin improved toll-like receptor 5 stimulating activity

ActiveUS8236327B2Enhanced TLR-stimulating activityPotent mucosal vaccine adjuvant effectAntibacterial agentsBacterial antigen ingredientsAgonistFlagellin
Disclosed herein are flagellin mutants having an enhanced activity of stimulating the toll-like receptor-5 (hereinafter referred to as “TLR5”). More specifically, disclosed are flagellin mutants, prepared by point-mutating some of the amino acids of a TRL5 agonist flagellin so as to enhance the TRL-stimulating activity of the flagellin.
Owner:IND FOUND OF CHONNAM NAT UNIV

Toll-like receptor 5 ligands and methods of use

The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT (SEQ ID NO:2), or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
Owner:UNIV OF WASHINGTON +1

Modified flagellin improved toll-like receptor 5 stimulating activity

ActiveCN101622272AEnhance stimulating activityEffective adjuvant potencyDepsipeptidesAntibody medical ingredientsMedicineAgonist
Disclosed herein are flagellin mutants having an enhanced activity of stimulating the toll-like receptor-5 (hereinafter referred to as ''TLR5''). More specifically, disclosed are flagellin mutants, prepared by point-mutating some of the amino acids of a TRL5 agonist flagellin so as to enhance the TRL-stimulating activity of the flagellin.
Owner:李浚行 +1

Flagellin-containing protein nanoparticles as a vaccine platform

The present invention relates to self-assembling protein nanoparticles constructed from suitable oligomerization domains and further incorporating the TLR5 binding protein flagellin as an adjuvant molecule. Furthermore, the invention relates to the use of such nanoparticles for vaccination.
Owner:ALPHA O PEPTIDES

Application of Cap-TFlg protein in preparing PCV2 vaccine

The invention aims to disclose application of Cap-TFlg protein in preparing a PCV2 vaccine. TFlg is blended with a C terminal of PCV2Cap protein so as to be displayed on the surface of PCV2 VLPs, anda TLR5 passageway is activated to improve an immune effect of a PCV2 VLPs vaccine. By utilizing a bioinformatics means, through an independent design, ORF2 and flagellin (TFlg) genes of porcine circovirus 2 type are subjected to pronucleus codon optimization, and Cap and Cap-TFlg protein expression genes suitable for being high-efficiently expressed in escherichia coli are artificially synthesized. The Cap and Cap-TFlg VLPs provided by the invention and an appropriate adjuvant are mixed to immunize piglets, the immune response of the piglets can be remarkably improved through the Cap-TFlg VLPs, and better immunogenicity and protectiveness are realized.
Owner:杨凌凯瑞生物科技有限公司

RNAi-BASED THERAPEUTICS FOR ALLERGIC RHINITIS AND ASTHMA

The present invention provides compositions comprising one or more RNAi agents (e.g., siRNAs, shRNAs, or RNAi vectors) for the treatment of conditions and diseases mediated by (e.g., featuring IgE-mediated hypersensitivity), as well as systems for identifying RNAi agents effective for this purpose. The compositions are suitable for the treatment of allergic rhinitis and / or asthma. In certain embodiments of the invention the RNAi agent is targeted to a transcript that encodes a protein selected from the group consisting of the FCεRIα chain, the FCεRIβ chain, c-Kit, Lyn, Syk, ICOS, OX40L, CD40, CD80, CD86, Re1A, Re1B, 4-1BB ligand, TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, CD83, SLAM, common γ chain, and COX-2. In addition, the invention provides RNAi agent / delivery agent compositions and methods of use. In certain embodiments of the invention compositions comprising an RNAi agent are delivered by the respiratory route.
Owner:MASSACHUSETTS INST OF TECH

Method for amplifying cd8+t cells and cell subpopulations thereof in-vitro

PendingUS20200063103A1Improve efficiencyEnhance the in-vitro amplification efficiency of the CD8+ T cellsCell dissociation methodsBlood/immune system cellsAgonistTLR5
Disclosed is a method for rapidly amplifying CD8+ T cells and functional cell subpopulations thereof in vitro. A TLR1 / 2 agonist, a TLR2 / 6 agonist and a TLR5 agonist or a combination of above agonists is added to a conventional culture system for in-vitro amplification of CD8+ T cells. Recombinant cytokines IL-2, IL-7 and IL-15 as well as magnetic beads coated with an anti-human CD3 antibody and an anti-human CD28 antibody can be further added to the culture system for continuous co-stimulation.
Owner:SHANGHAI INNOVATIONAL CHANGAN BIOLOGICAL TECH CO LTD

NF-kB dual-luciferase reporter cell for stably expressing swine TLR5 receptor genes and construction method

The invention belongs to the technical field of biology and in particular relates to an NF-kB dual-luciferase reporter cell for stably expressing swine TLR5 receptor genes and a construction method thereof. A cell line refers to HEK293-NF-kB cells in which the swine TLR5 receptor genes are transferred, and the HEK293-NF-kB cells refer to HEK293 cells in which NF-kB firefly luciferase and renilla luciferase are transferred. The invention provides the stable cell line used in detection for researching pTLR5 activated downstream NF-kB promoter report genes. The invention also provides a biological material for performing high-throughput screening on differentially expressed genes in stable cells in quiesced and activated states in an RNA-Seq technology, and lays a foundation and platform forfurther researching species specificity of TLR5.
Owner:YANGZHOU UNIV

Predictive models and methods for diagnosing and assessing coronary artery disease

Biomarkers useful for diagnosing and assessing the extent of coronary artery disease (CAD) are provided, along with kits for measuring their expression. The invention also provides predictive models, based on the biomarkers, as well as computer systems, and software embodiments of the models for scoring and optionally classifying samples. In a preferred embodiment, the biomarkers are organized into clustered groups. The expression level of the biomarkers within a group are highly correlated to each other in normal and disease states. Expression values of genes chosen from each of two, three, four or five of the clustered gene groups, A, B, C, D, E may be used. Alternatively, expression values of genes chosen from the groups are combined into a metagene. Preferred biomarkers include S100A12, S100A8, S100A9, BCL2A1, and F5 (group A); XK, P62, and FECH (group B); TUBB2 (group C); IFNG, PDGFB, VSIG4, and TNF (group D); CSF3R, TLR5, CD46, and NCF1 (group E); S100A12, S100A9, BCL2A1, TXN and CSTA (group I); OLIG1, OLIG2, ADORA3, CLC, and SLC29A1 (group II); and CBS and ARG1 (group IV).
Owner:CARDIODX

Genetic molecular marking method for disease-resistant breeding of pigs, and application thereof

The invention discloses a genetic molecular marking method for disease-resistant breeding of pigs, and application thereof. The genetic molecular marking method includes the following steps of firstly, screening and determining the variation points of the TLR5 genes of the pigs; secondly, amplifying sequences comprising the determined variation points; thirdly, performing SSCP (single stranded conformation polymorphism) analysis on the amplified products of the second step, and comprehensively detecting the genotypes of pig core groups; fourthly, analyzing the correlation between individual genotypes and important cytokines representing general disease resistance, and selecting samples having three of four PCR-SSCP bands of the amplified products as advantageous individuals in the disease-resistant breeding. The genetic molecular marking method for the disease-resistant breeding of the pigs has high accuracy and can be used for mass detection, thereby providing an effective molecular marker breeding measure for improving the immune response capability and general disease resistance of piglets; when a genetic molecular marker is applied to the disease-resistant breeding, the breeding progress can be accelerated.
Owner:YANGZHOU UNIV

Modulation of Toll-Like Receptor 5 Expression by Antisense Oligonucleotides

InactiveUS20100111937A1Efficiently inhibit expressionEfficient expressionAntibacterial agentsSenses disorderDiseaseTLR5
Antisense oligonucleotide compounds, compositions and methods are provided for down regulating the expression of TLR5. The compositions comprise antisense oligonucleotides targeted to nucleic acids encoding TLR5. The compositions may also comprise antisense oligonucleotides targeted to nucleic acids encoding TLR5 in combination with other therapeutic and / or prophylactic compounds and / or compositions. Methods of using these compounds and compositions for down-regulating TLR5 expression and for prevention or treatment of diseases wherein modulation of TLR5 expression would be beneficial are provided.
Owner:IDERA PHARMA INC

Methods for detecting and treating cancers having adenosine pathway activation

This disclosure relates to methods for detecting a level of expression of one or more genes (or proteins) in a subject having or suspected of having cancer, and optionally treating the subject with anadenosine pathway antagonist, for example an adenosine A2A receptor (ADORA2A) antagonist, to treat the cancer. The genes (or proteins) include, without limitation, CD68, CD163, LBP, CCL2, CCL3, CCL7,CCL24, CCNE1, CD 14, CD300E, CD86, CD93, CLEC5A, CSF3, CXCL1, CXCL2, CXCL3, CXCL5, CXCL6, CXCL8, DFNA5, ECEL1, EPB41L3, EHF, FUT7, GALM, GBP6, GPR157, HAS1, IL1A, IL-1[beta], IL23, IL24, IL5, IL6, IL8, INHBA, LAP3, LAYN, LOC100505585, MRPL11, NID1, OST4, PADI2, PID1, PLAUR, PPBP, PTGS2, RHCG, SERPINB2, SLC11A1, SLC7A7, SPON1, ST6GALNAC2, TBX21, THBS1, C1R, C1S, C4BPA, CCL11, CCL20, CXCL16, CXCL2,HAMP, HSD11B1, ITGAM, LIF, SAA1, TFRC, TLR5, TNFSF14, TREM2, APP, ATG10, BCL2, CCL15, CD24, CD46, CD59, CREB5, CX3CL1, CXCL14, CYFIP2, DEFB1, DPP4, ECSIT, EPCAM, IFIT1, IGF1R, ITGA6, ITGB3, MAP2K4, MAPK1, MASP1, PPARG, RORC, SPA17, STAT5B, TOLLIP, AKT3, BMI1, CD 164, CD34, CDH5, CREB1, DOCK9, ENG, HMGB1, ITGA1, JAM3, MAF, MAPK3, MAPK8, MCAM, MFGE8, NOTCH1, NRP1, PRKCE, SMAD2, TAL1, THY1, TNFSF12,TRAF6, TXNIP, VEGFA, S100A8, and / or WDR83OS.
Owner:CORVUS PHARMACEUTICALS INC

New ionizing radiation damage resistance function of polyethyleneimine compounds, and its application

The invention relates to a new ionizing radiation damage resistance function of polyethyleneimine (PEI) compounds, and its application. The PEI mainly has two structures comprising a linear structure (the molecular formula is (C2H5N)x) and a branched structure (the molecular formula is (C2H5N)x[-N(C2H6N)C2H4-]y), wherein each of x and y is an integer not lower than 1. The PEI can specifically activate a cell TLR5 acceptor mediated NF-kappaB signal channel. Results of experiment researches show that the PEI is weakly toxic to cells and animals, can substantially activate the cell TLR5 acceptor mediated NF-kappaB signal channel and display a dosage dependency, and can substantially reduce the mortality of ionizing radiation damaged mice and prolong the animal survival time. The new ionizing radiation damage resistance function of the PEI can be used for researching medicines for preventing and treating ionizing radiation damages and damages caused by radiotherapy.
Owner:INST OF RADIATION MEDICINE ACAD OF MILITARY MEDICAL SCI OF THE PLA

Systems, methods, and gene signatures for predicting a biological status of an individual

Systems and methods for assessing a subject's sample to predict the subject's biological status, such as a smoker status. The computer-implemented method includes receiving, by a computer system including at least one hardware processor, a data set associated with the sample. The data set comprises quantitative expression data for a set of genes less than a whole genome, the set of genes comprising AHHR, CDKN1C, LRRN3, PID1, GPR15, SASH1, CLEC10A, LINC00599, P2RY6, DSC2, F2R, SEMA6B, and TLR5. The at least one hardware processor generates a score based on the quantitative expression data for the set of genes in the received data set, wherein the score is based on fewer than 40 genes and is indicative of a predicted smoking status of the subject.
Owner:PHILIP MORRIS PROD SA

In vitro method and kit for prognosis or prediction of response by patients with rheumatoid arthritis to treatment with TNF-alpha factor blocking agents

In vitro method and kit for prognosis or prediction of the response of rheumatoid patients to treatment with TNF-α factor blocking agents, which comprises determining, in a blood sample from said patients, the expression level of at least one of the eight genes selected from the group: HLA-DRB3, EAT2, GNLY, CAMP, SLC2A3, IL2RB, MXD4 and TLR5 or combinations thereof and comparing said expression level to the expression values obtained from responsive and non-responsive patients who showed responsiveness to the treatment and those who showed non-responsiveness thereto.
Owner:FUNDACIO INST DE RECERCA DE LHOSPITAL UNIVRI VALL DHEBRON +1

Composition for preventing or treating graft-versus-host disease comprising tlr5 agonist derived from flagellin as effective component

The present disclosure relates to a composition for preventing or treating graft-versus-host disease (GVHD) containing a TLR5 agonist derived from flagellin as an active ingredient. The TLR5 agonist derived from flagellin according to the present disclosure exhibits an excellent therapeutic effect against GVHD, and thus may be developed as an active ingredient for a composition for the treatment, prevention or alleviation of GVHD.
Owner:THE CATHOLIC UNIV OF KOREA IND ACADEMIC COOP FOUND

Methods of increasing vaccine efficacy

PendingUS20220288198A1Improving and increasing efficacyPatient's immune response is enhanced or promotedBacterial antigen ingredientsDepsipeptidesVaccine PotencyAgonist
The present invention relates, in part, to compositions and methods for enhancement of an immune response and for increased vaccine efficacy by stimulation of the TLR5 receptor, for example, with a recombinant TLR5 agonist (e.g., a flagellin-based agent or variant thereof).
Owner:GENOME PROTECTION INC

Composition for preventing or treating graft-versus-host disease comprising tlr5 agonist derived from flagellin as effective component

The present invention relates to a composition for preventing or treating graft-versus-host disease (GVHD), comprising a TLR5 agonist derived from flagellin as an effective component. The TLR5 agonist derived from flagellin of the present invention exhibits an excellent therapeutic effect on GVHD, and thus may be developed as an active ingredient of a composition for the treatment, prevention, or alleviation of GVHD.
Owner:ザカソリックユニバーシティーオブコリアインダストリーアカデミックコーポレーションファウンデーション

Modified flagellin improved toll-like receptor 5 stimulating activity

ActiveUS20110008378A1Enhanced TLR-stimulating activityPotent mucosal vaccine adjuvant effectAntibacterial agentsBacterial antigen ingredientsAgonistTLR5
Disclosed herein are flagellin mutants having an enhanced activity of stimulating the toll-like receptor-5 (hereinafter referred to as “TLR5”). More specifically, disclosed are flagellin mutants, prepared by point-mutating some of the amino acids of a TRL5 agonist flagellin so as to enhance the TRL-stimulating activity of the flagellin.
Owner:IND FOUND OF CHONNAM NAT UNIV

Improved flagellin serving as immunologic adjuvant, and preparation method and application of improved flagellin

ActiveCN103044530BBacteriaMicroorganism based processesAdjuvanticityWild type
The invention provides improved flagellin serving as an immunologic adjuvant, and a preparation method and an application of the improved flagellin. A salmonella typhimurium flagellin mutant of the improved flagellin has bioactivity of flagellin, and contains I411A mutation compared with the wild salmonella typhimurium flagellin. The salmonella typhimurium flagellin mutant of the improved flagellin can weaken TLR5 (toll-like receptor) mediated natural immune response, and has significant adjuvanticity.
Owner:YANGZHOU UNIV

Use of Toll-like receptor 5 (TLR5) agonist stFla in anti-pulmonary fibrosis

The invention discloses an application of a TLR5 agonist in the preparation of pulmonary fibrosis treatment medicines, and the preferable TLR5 agonist is selected from stFla. The fibrosis which is a primary pathologic base of the disability causing and the death causing of many chronic diseases severely threatens the health and lives of people. The incidence rate and the fatality of the pulmonary fibrosis have continuously rising trends. The TLR5 agonist, preferably the TLR5 agonist selected from the stFla, disclosed in the invention can substantially reduce the mortality of bleomycin induced pulmonary fibrosis mice, activate the TLR5 signal path, substantially reduce the pulmonary inflammation reactions caused by the bleomycin, and mitigate the pulmonary tissue fibrosis degree caused by the bleomycin, comprising the pulmonary collagen deposition, the hydroxyproline content and the -SMA expression.
Owner:INST OF MATERIA MEDICA CHINESE ACAD OF MEDICAL SCI